Protein List

Your search: Class in [Cyclotide] and Protein type in [Wild type]

Found 724 entries.


ID Name Sequence
805 caripe 1 GVIPCGESCVFIPCISTVIGCSCKDKVCYRN
1133 caripe 10 GVIPCGESCVFIPCFSTVIGCSCKNKVCYRN
1134 caripe 11 GVIPCGESCVFIPCISTVIGCSCKKKVCYRN
1135 caripe 12 GVIPCGESCVFIPCFSSVIGCSCKNKVCYRN
1136 caripe 13 GIPCGESCVFIPCFTSVFGCSCKDKVCYRN
806 caripe 2 GIPCGESCVFIRCTITALLGCSCSNNVCYKN
808 caripe 4 LICSSTCLRIPCLSPRCTCRHHICYLN
810 caripe 6 GAICTGTCFRNPCLSRRCTCRHYICYLN
827 caripe 7 GIPCGESCVFIPCTVTALLGCSCKNKVCYRN
828 caripe 8 GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
346 CD-1 GADGFCGESCVYIPCISYLVGCSCDTIEKVCKRN
811 chacur 1 GLPVCGETCVGGTCNTPGCTCSWPICTRN
869 chassatide C1 GDACGETCFTGICFTAGCSCNPWPTCTRN
874 chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN
875 chassatide C11 IPCGESCVWIPCISGMFGCSCKDKVCYS
876 chassatide C12 EYCGESCYLIPCFTPGCYCVSRQCVNKN
862 chassatide C13 GFPCAESCVYIPCTVTALLGCSCRNRVCYRN
864 chassatide C14 GIPCAESCVYIPCTITALFGCSCKDKVCYNN
861 chassatide C15 GIPCAESCVYIPCTITALLGCSCKDKVCYKN
860 chassatide C16 GVPCAESCVYIPCTITALFGCSCKDKVCYNN
863 chassatide C17 IPCGESCVYIPCISAVLGCSCQNKVCYR
859 chassatide C18 GIPCGESCVFIPCISALLGCSCSNKVCYNN
868 chassatide C2 GIPCAESCVWIPCTITALMGCSCKNNVCYNN
870 chassatide C3 GIPCGESCVWIPCISSALGCSCKNKVCYRN
867 chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN
871 chassatide C5 GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
872 chassatide C6 GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
866 chassatide C7 IPCGESCVWIPCITAIAGCSCKNKVCYT
865 chassatide C8 AIPCGESCVWIPCISTVIGCSCSNKVCYR
873 chassatide C9 GIPCGESCVFIPCVTTVIGCSCKDKVCYNN
8 circulin A GIPCGESCVWIPCISAALGCSCKNKVCYRN
45 circulin B GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
48 circulin C GIPCGESCVFIPCITSVAGCSCKSKVCYRN
49 circulin D KIPCGESCVWIPCVTSIFNCKCENKVCYHD
50 circulin E KIPCGESCVWIPCLTSVFNCKCENKVCYHD
51 circulin F AIPCGESCVWIPCISAAIGCSCKNKVCYR
975 cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN
977 cliotide T10 GIPCGESCVYIPCTVTALLGCSCKDKVCYKN
978 cliotide T11 GIPCGESCVFIPCTITALLGCSCKDKVCYKN
766 cliotide T12 GIPCGESCVFIPCITGAIGCSCKSKVCYRD
966 cliotide T13 DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
967 cliotide T14 DTIPCGESCVWIPCISSILGCSCKDKVCYHN
968 cliotide T15 GLPICGETCFKTKCYTKGCSCSYPVCKRN
969 cliotide T16 GSVIGCGETCLRGRCYTPGCTCDHGICKKN
970 cliotide T17 GTVPCGESCVFIPCITGIAGCSCKNKVCYLN
971 cliotide T18 GLPICGETCFTGTCYTPGCTCSYPVCKKN
972 cliotide T19 GSVIKCGESCLLGKCYTPGCTCSRPICKKN
765 cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN
973 cliotide T20 GSAIRCGESCLLGKCYTPGCTCDRPICKKN
974 cliotide T21 DLQCAETCVHSPCIGPCYCKHGLICYRN
979 cliotide T28 GGSIPCGESCVFLPCFLPGCSCKSSVCYLN
980 cliotide T32 GDLFKCGETCFGGTCYTPGCSCDYPICKNN
981 cliotide T33 GFNSCSEACVYLPCFSKGCSCFKRQCYKN
982 cliotide T40 GIPCGESCVFIPCTITALLGCSCKSKVCYKN
983 cliotide T54 GIPCGESCVYIPCTVTALLGCSCKNKVCYRN
984 cliotide T55 GVIPCGESCVFIPCISTLIGCSCKNKVCYRN
976 cliotide T6 SIPCGESCVYIPCLTTIVGCSCKNSVCYSN
759 cliotide T8 GIPCGESCVFIPCISSVVGCSCKSKVCYNN
762 cliotide T9 GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
1089 cT22 ARIPCGESCVWIPCTITALVGCACHEKVCYKS
1081 cT23 GFPCGESCVFIPCTVTALLGCSCKDKVCYKN
1091 cT25 GSIRCGERCLLGRCHRPGCTCVRRICRRN
1093 cT26 GFICGESCVYIPCITALLGCSCSNQICSKN
1082 cT27 GVIPCGESCVFIPCITGAIGCSCKSKVCYRN
1096 cT30 GDPLKCGESCFAGKCYTPGCTCSRPICKKN
1098 cT31 GDPLKCGESCFAGKCYTPGCTCDRPICKKN
1516 cT38 KIPCGESCVWIPCFTSAFGCYCQSKVCYHS
1103 cT42 DIPCGSTCLHVKCIPPCYCKNKVLCYRN
1083 cT45 CGESCVFLPCFIIPGCSCKDKVCYLN
986 Cter 1 GLPICGETCFGGTCNTPNCVCDPWPICTNN
994 Cter 10 SYIPCGESCVYIPCTVTALLGCSCSNKVCYKN
995 Cter 11 GSIRCGERCLLGRCHRPGCTCIRRICRRN
996 Cter 12 NTAFCGETCVLGTCYTPDCSCKAVVCIKN
997 Cter 13 GSAIRCGERCLLGRCHRPGCTCIRRICRRN
998 Cter 15 GIPCGESCVFIPCTVTALLGCSCKSKVCYKN
999 Cter 18 DLICSSTCLHTPCKASVCYCKNAVCYKN
1000 Cter 19 SIPCGESCVYIPCLTTIVGCSCKSNVCYSN
987 Cter 2 GDPLKCGESCFAGKCYTPGCTCEYPICMNN
1001 Cter 20 GVIPCGESCVYLPCLTTIVGCSCKNNVCYTN
1002 Cter 22 NTAFCGETCVLGTCYTPDCSCTAIVCIKN
1003 Cter 25 GNPIVCGETCFFQKCYTPGCSCDAVICTNN
1004 Cter 28 GVIPCGESCVWIPCISAAIGCSCKKNVCYRN
1005 Cter 29 GALCDERCTYVPCISAARGCSCNIHRVCSMN
988 Cter 3 GAFCGETCVLGTCYTPDCSCKAVVCIKN
1006 Cter 30 GFPICGETCFKTKCYTPGCSCSYPVCKKN
1007 Cter 31 DLQCAETCVHSPCIGPCYCKHGVICYKN
1008 Cter 32 KIPCGESCVWIPCISSILGCSCKDKVCYHN
1009 Cter 33 GDLFKCGETCFGGTCYTPGCSCDYPICKKN
1010 Cter 35 GAFCGETCVLGTCYTPGCSCAPVICLNN
1011 Cter 36 GSPTCGETCFGGTCYTPNCVCDPWPICTKN
1012 Cter 37 GSPTCGETCFGGTCYTPGCVCDPWPICTKN
989 Cter 4 GDPLACGETCFGGTCYTPGCVCDPWPICTKN
990 Cter 5 GGEFLKCGESCVQGECYTPGCSCDYPICKNN
991 Cter 7 GDPFKCGESCFAGKCYTPGCTCEYPICMNN
992 Cter 8 GSAFCGETCVLGTCYTPDCSCKAVVCIKN
993 Cter 9 GIPCGESCVYIPCTVTALLGCSCRDKVCYKN
477 Cter A GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
1065 Cter acyc 1 VDGFCLETCVILPCFSSVAGCYCHGSTCMRG
478 Cter B GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
585 Cter C GVPCAESCVWIPCTVTALLGCSCKDKVCYLD
586 Cter D GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
587 Cter E GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
588 Cter F GIPCGESCVFIPCISSVVGCSCKSKVCYLD
589 Cter G GLPCGESCVFIPCITTVVGCSCKNKVCYNN
590 Cter H GLPCGESCVFIPCITTVVGCSCKNKVCYND
591 Cter I GTVPCGESCVFIPCITGIAGCSCKNKVCYIN
592 Cter J GTVPCGESCVFIPCITGIAGCSCKNKVCYID
593 Cter K HEPCGESCVFIPCITTVVGCSCKNKVCYN
594 Cter L HEPCGESCVFIPCITTVVGCSCKNKVCYD
595 Cter M GLPTCGETCTLGTCYVPDCSCSWPICMKN
596 Cter N GSAFCGETCVLGTCYTPDCSCTALVCLKN
597 Cter O GIPCGESCVFIPCITGIAGCSCKSKVCYRN
598 Cter P GIPCGESCVFIPCITAAIGCSCKSKVCYRN
1429 cter pep 4 GDALKCGETCFGGTCYTPGCSCDYPICKKN
599 Cter Q GIPCGESCVFIPCISTVIGCSCKNKVCYRN
600 Cter R GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
1433 ctr pep 11  ANIPMTCGPCLTDECWTPGCEYHCKYCKNS
1435 ctr pep 18  GISCGESCVFIPCITGIAGCSCKNKVCYLN
1439 ctr pep 20  CVIPCGESRVFIPCITGAIGCSCKSKVCYRN
1440 ctr pep 22  GSITGCGGGCLLGRCYRPGCTCVRRICRRN
1442 ctr pep 24  GSAIRCGERCLLGRCHRPGCTCVRRICRRN
1443 ctr pep 26  GSSIVTCGETCLRGKCYTPGCTCVRPICKKN
1444 ctr pep 29  GDPFKCGESCFAGKCYTPGCTCSRPICKKN
1428 ctr pep 3 GRPTCGETCFKTKCYTPGCSCSYPICKKN
1445 ctr pep 30  GSPCGESCVFIPCISTVIGCSCKNKVCYRN
1446 ctr pep 31  GIPCGESCVYIPCTVTALLGCSCKNKVCFRN
1447 ctr pep 33  GIPCGESCVFISCTVTALLGCSCKDKVCYKN
1448 ctr pep 35  NIFPCGESCVYIPCITSIVGCSCQNKVCYNN
1449 ctr pep 37  DTIPCGESCVFIPCTSSVLGCSCKDKFCYNN
1450 ctr pep 38  GGTACGESCIYLPCISGVFEGCSCQNKACYKN
1451 ctr pep 43  GIPCGESCVFLPCFIIPGCSCKDKVCYLN
1452 ctr pep 47  GIPCVESCVFIPCTVTALLGCSCKDKVCYKN
1453 ctr pep 48  GVPCGESCVYIPCTVTALLGCSCKNKVCYRN
1431 ctr pep 6  GCLPICGETCFKTKCYTKGCSCSYPICKKN
1432 ctr pep 8  GRPTCGETCFKTKCYTKGCSCSYPVCKRN
32 cyclopsychotride A SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
33 cycloviolacin H1 GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
140 cycloviolacin H2 SAIACGESCVYIPCFIPGCSCRNRVCYLN
139 cycloviolacin H3 GLPVCGETCFGGTCNTPGCICDPWPVCTRN
169 cycloviolacin H4 GIPCAESCVWIPCTVTALLGCSCSNNVCYN
2 cycloviolacin O1 GIPCAESCVYIPCTVTALLGCSCSNRVCYN
57 cycloviolacin O10 GIPCGESCVYIPCLTSAVGCSCKSKVCYRN
28 cycloviolacin O11 GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
38 cycloviolacin O12 GLPICGETCVGGTCNTPGCSCSWPVCTRN
170 cycloviolacin O13 GIPCGESCVWIPCISAAIGCSCKSKVCYRN
174 cycloviolacin O14 GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
175 cycloviolacin O15 GLVPCGETCFTGKCYTPGCSCSYPICKKN
176 cycloviolacin O16 GLPCGETCFTGKCYTPGCSCSYPICKKIN
177 cycloviolacin O17 GIPCGESCVWIPCISAAIGCSCKNKVCYRN
178 cycloviolacin O18 GIPCGESCVYIPCTVTALAGCKCKSKVCYN
179 cycloviolacin O19 GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
21 cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN
180 cycloviolacin O20 GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
181 cycloviolacin O21 GLPVCGETCVTGSCYTPGCTCSWPVCTRN
182 cycloviolacin O22 GLPICGETCVGGTCNTPGCTCSWPVCTRN
183 cycloviolacin O23 GLPTCGETCFGGTCNTPGCTCDSSWPICTHN
184 cycloviolacin O24 GLPTCGETCFGGTCNTPGCTCDPWPVCTHN
185 cycloviolacin O25 DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
516 cycloviolacin O26 GSIPACGESCFRGKCYTPGCSCSKYPLCAKD
517 cycloviolacin O27 GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
507 cycloviolacin O28 GLPVCGETCVGGTCNTPGCSCSWPVCFRD
514 cycloviolacin O29 GIPCGESCVWIPCISGAIGCSCKSKVCYKN
53 cycloviolacin O3 GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
515 cycloviolacin O30 GIPCGESCVWIPCISSAIGCSCKNKVCFKN
505 cycloviolacin O31 GLPVCGETCVGGTCNTPGCSCSIPVCTRN
508 cycloviolacin O32 GAPVCGETCFGGTCNTPGCTCDPWPVCTND
509 cycloviolacin O33 GLPVCGETCVGGTCNTPYCTCSWPVCTRD
512 cycloviolacin O34 GLPVCGETCVGGTCNTEYCTCSWPVCTRD
513 cycloviolacin O35 GLPVCGETCVGGTCNTPYCFCSWPVCTRD
546 cycloviolacin O36 GLPTCGETCFGGTCNTPGCTCDPFPVCTHD
52 cycloviolacin O4 GIPCGESCVWIPCISSAIGCSCKNKVCYRN
54 cycloviolacin O5 GTPCGESCVWIPCISSAVGCSCKNKVCYKN
55 cycloviolacin O6 GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
56 cycloviolacin O7 SIPCGESCVWIPCTITALAGCKCKSKVCYN
27 cycloviolacin O8 GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
34 cycloviolacin O9 GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
550 cycloviolacin T1 GIPVCGETCVGGTCNTPGCSCSWPVCTRN
347 cycloviolacin Y1 GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN
348 cycloviolacin Y2 GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTN
349 cycloviolacin Y3 GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTN
350 cycloviolacin Y4 GVPCGESCVFIPCITGVIGCSCSSNVCYLN
351 cycloviolacin Y5 GIPCAESCVWIPCTVTALVGCSCSDKVCYN
67 cycloviolin A GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
68 cycloviolin B GTACGESCYVLPCFTVGCTCTSSQCFKN
69 cycloviolin C GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
70 cycloviolin D GFPCGESCVFIPCISAAIGCSCKNKVCYRN
1203 cyI1 GTFPCGESCVYIPCISSVVGCSCKSKVCYKN
1204 cyI2 GTFPCGESCVWIPCISSVVGCSCKSKVCYKN
1205 cyI3 GNPGACGETCIWGKCYSASIGCSCSKYKVCTLN
1206 cyI4 GNPGACGETCVWGKCYSASIGCSCNKYKVCTLN
1207 cyI5 GNPGACGETCIWGKCYSASIGCSCSRYKVCTLN
1208 cyI6 GNPGACGETCIWGKCYSAKIGCSCSKYKICTLN
1217 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD
1218 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD
1220 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD
534 Globa A GIPCGESCVFIPCITAAIGCSCKTKVCYRN
535 Globa B GVIPCGESCVFIPCISAVLGCSCKSKVCYRN
539 Globa C APCGESCVYIPCLLTAPIGCSCSNIVCYRN
536 Globa D GIPCGETCVFMPCISGPMGCSCKHMVCYRN
538 Globa E GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
533 Globa F GSFPCGESCVFIPCISAIAGCSCKNKVCYKN
542 Glopa A GGSIPCIETCVWTGCFLVPGCSCKSDKKCYLN
543 Glopa B GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
544 Glopa C GDIPLCGETCFEGGNCRIPGCTCVWPFCSKN
540 Glopa D GVPCGESCVWVPCTVTALMGCSCVREVCRKD
541 Glopa E GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
1295 Glopa F GRLPCGESCVFLPCLSVSLGCSCKNKVCYRN
1296 Glopa G GRLPCGESCVFLPCLSAVLGCSCKNKVCYRN
613 HB1 GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
1314 HB10 GISCAETCVKLPCLSSVIGCTCQNKRCYKD
1315 HB11 GISCGETCVLLPCLSSVIGCTCQNKRCYKN
746 HB2 IQCGESCVWIPCISSAWGCSCKNKICSS
1326 HB3 QCGESCVWIPCISSAWGCSCKNKICSS
1327 HB4 QCGESCVWIPCISSAWGCSCKNKICSS
1321 HB5 GAVPCGESCVYLPCLTTVVGCSCQNSVCYHN
1322 HB6 GAVPCGETCVYLPCITAAIGCSCQNKVCYRD
1323 HB7 GISCAETCVLLPCLSSVIGCTCQNKRCYKN
1324 HB8 GIPCGESCAFLPCLTSLLGCTCQNKVCYRD
1325 HB9 GNPCGESCVYLPCITTVVGCSCQNSVCYHN
113 hcf-1 GIPCGESCHYIPCVTSAIGCSCRNRSCMRN
501 hcf-1 variant GIPCGESCHIPCVTSAIGCSCRNRSCMRN
1300 Hobo A GLPTCGETCTLGTCNTPGCTCSWPLCTKN
114 htf-1 GIPCGDSCHYIPCVTSTIGCSCTNGSCMRN
1297 Hyde B GVLPCGESCVFDRTCHLAGCGCGSTVPLCVRN
1534 hyen AA GSPCGEYCVFHPSCITAIIGCSCRNRVCYKN
1536 hyen AB GIIPCGETCIWDKTCHIPGCKCEHNICVRN
1537 hyen AC GTPCGESCVWIPCVTTIVGCSCKSNVCYLN
1538 hyen AD GIIPCGETCIWDKKCHIQGCSCKHDICVRN
1539 hyen AE GFPCGESCVYIPCTVTALWGCACWEHVCYTN
1540 hyen AF GIPCAESCVWIPCTVTALLGCSCSDKVCYN
1541 hyen AG GAMPCGESCVYIPCTVTALLGCSCKNNVCYKN
1542 hyen AH GIIPCGESCVWIPCTVTAVMGCSCKDNVCYRN
1543 hyen AI GIPCGESCFWIPCTVTSLLGCSCKSSVCYKY
1544 hyen AJ GVIPCGESCVYIPCTVTALLGCSCSNKVCYKN
1545 hyen AK SIPCGETCVWLPCFIVPGCSCKDKVCYIN
1546 hyen AL GLIPCGESCVLIPCISTIIGCSCKNKVCYRN
1547 hyen AM RFTSCQEGCFFRPCTTPGCRCLADLCVKN
1548 hyen AN GIKIPCGESCAWVDFCFTSIVGCSCENKVCYKN
1549 hyen AO KIPCGESCAWVDFCFTSIVGCSCENKVCYKN
1550 hyen AP GIPCGESCVFIPCLTAAIGCSCSNRVCYRN
1551 hyen AQ KVPCGESCAWVNFCFTSVVGCSCQDKVCYMN
1552 hyen AR SIPCGESCVFIPCFTRVIGCSCRNKVCYRG
1553 hyen AS QVSCGETCKSGPCSYPRCTCTAKICVLY
1554 hyen AT AIPCGESCVFIPCFTKVIGCSCRSRVCYL
1556 hyen AU ELISCGESCVYFPCITRIVGCRCRRNVCWLQ
1557 hyen AV PAAFPCGESCVYIPCLTTAIGCSCKNKVCYHD
1558 hyen AW PAAFPCGESCVYIPCVTTLIGCSCKDKVCYHD
1559 hyen AX IPCLESCVYLPCIFTGPTLGCSCKNNVCYR
1560 hyen AY GIPCGESCGESCVWIPCISSVLGCSCSNKVCYRN
1561 hyen AZ GRPCGEYCLFGRSCVTAVIGCSCSNNVCYQN
1525 hyen B GLAKSCGETCKVTKRCSGQGCSCLKGRSCYD
1562 hyen BA DLICSQTCFSHPCVPQCVCRNFICYRN
1563 hyen BB ALICGESCFTGKCYSEVIGCGCSWPLCKKN
1564 hyen BC PLICGETCFTGTCYSAQIGCSCSWPVCMKN
1599 hyen BE GIPCGESCGESCVFIPCLTSAIGCSCKSKVCYRN
1565 hyen BF YYCGETCKFITCTFSRLEWCSCQNKRCMNN
1566 hyen BG SIPCGESCVIIPCITGIFGPCSCKSKVCYFN
1567 hyen BH GTPCGESCVYIPCLTTIVGCSCKSNVCYLN
1568 hyen BI SVPCGESCVFIPCVTGIIGCECKSKVCYLN
1569 hyen BJ GLIPCGESCVWIPCFSAAIGCSCNGQDHVCYRN
1570 hyen BK GIPCAESCVYIPCIVSVILGCSCQSKVCYN
1571 hyen BL TPCGETCKYIPCITLIYPPCECKDGLCVWPSVD
1572 hyen BM GIPCGESCVWIPCLSSAFGCSCRSKVCYRN
1573 hyen BN GLQRCRESCNRVKCWLPGCECLNKMCYKN
1574 hyen BO ALFCGESCFVGSCNKSPAGCRCSYPFCIKN
1575 hyen BP GFHCRESCRHTRCSIAACSCSKDKYCMRN
1576 hyen BQ GFSCGQSCVFLPCLNPGPIPPSCRCVKGECVRN
1577 hyen BR GIPCPGSCFFIDCNPGPFPPSCKCKGGMCVRN
1578 hyen BS AVPCGESCVWIPCISSIAGCSCSNSVCYLN
1579 hyen BT VLSCIETCVYIPCITSLIGCSCKDKICYLN
1580 hyen BU FFPCTESCGVLPCLTSLIGCRCVDKICVKD
1581 hyen BV GIPCAESCVFIPCTITALLGCKCQSNVCYN
1582 hyen BW GIPCAESCVFIPCTITALLGCKCQSKVCYN
1583 hyen BX GIPCAESCVWIPCTVTALLGCKCQSNVCYN
1584 hyen BY AIPCGESCVWIPCFSSVIGCRCRSKVCYR
1585 hyen BZ GFLQSCGEGCFFKPCTKPGCTCLADLCVTN
1170 hyen C GTHPCQETCVTSTRCSTQGCHCNWPICFKN
1586 hyen CA SIPCGESCALFDFCFTAPLGCTCQNKVCYKN
1587 hyen CB GIPCGESCAWLPFCFTAPLGCTCQDKVCYRN
1588 hyen CC SIPCGESCAWFDFCFTAPLGCTCQNKVCSIN
1589 hyen CD SIGCGESCVYLGCFIIPACRTCRNNACYLN
1590 hyen CE GIPCGESCVFIPCITSIAGCSCQSKVCYLN
1591 hyen CF GPPCYSTCRFIPACVKTTWPQCVCKDGVCVVQ
1592 hyen CG SIPCGESCVYLPCFSAIFGCRCNEYSLCVKG
1593 hyen CH SIPCGESCVYLPCFSAIFGCRCNENRICVKG
1594 hyen CJ GIPCGESCVWLPCFTKYIGCGCQSKVCYY
1595 hyen CK GTPCGESCAFRPCISGRIGCQCKHRFCYR
1596 hyen CL IPCGERCEFMPCYTRVIACSCRNKVCYRGSS
1597 hyen CM SMPCGETCYFIPCLTKLINCECVNNICVLGA
1598 hyen CN IPCLESCVHLPCIFTGPTLGCSCKNNVCYR
1139 hyen D GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
1137 hyen E GVPCGESCVYIPCFTGIINCSCRDKVCYNN
1515 hyen F GLPCGESCVYIPCISTVLGCSCSNKVCYRN
1138 hyen G GLPCGESCVYIPCISTVLGCSCSNKVCYRD
1150 hyen H KIPCGESCVYIPCISSVLGCSCSNKVCYKD
1144 hyen I GSTPCGESCVWIPCISGIVGCSCSNKVCYMD
1149 hyen J GSVPCGESCVWIPCITSIAGCSCSNKVCYMD
1146 hyen K GIPCGESCIFIPCITTVVGCSCSNKVCYDN
1148 hyen L GIPCAESCVYIPCTVTALLGCSCSDKVCYN
1141 hyen M SIPCAESCVWIPCTVTALLGCSCSDKVCYN
1519 hyen N GIPCGESCVWIPCITAAVGCSCSNKVCYRN
1520 hyen O GIPCGESCVWIPCISSVLGCSCSNKVCYRN
1521 hyen P GAIPCGESCVYIPCISTVLGCSCSNKVCYKN
1522 hyen Q GIPCGESCVWLPCFIVPGCSCNDKVCYLN
1523 hyen R AVPCGESCVWIPCITSIAGCSCSNKVCYMN
1524 hyen S GIPCGESCVYIPCFTAAIGCSCSNKVCYRN
1526 hyen T GIPCGESCVWIPCISAAIGCSCSNKVCYRN
1528 hyen U GIPCGESCVWIPCFSAAIGCSCRSRVCYRN
1529 hyen V GIPCGESCVWIPCFSAAIGCSCRSKVCYRN
1530 hyen W AVPCGESCVIIPCFTGIVGCGCTNKVCYIN
1531 hyen X SIPCGESCVFIPCFTGVVGCGCTNKVCYIN
1532 hyen Y GIPCGESCVFIPCFTSAIGCSCKSKVCYRN
1533 hyen Z GTPCGESCVYIPCLSTVLGCSCSNRICYRN
141 Hyfl A SISCGESCVYIPCTVTALVGCTCKDKVCYLN
142 Hyfl B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
143 Hyfl C GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
144 Hyfl D GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
145 Hyfl E GEIPCGESCVYLPCFLPNCYCRNHVCYLN
146 Hyfl F SISCGETCTTFNCWIPNCKCNHHDKVCYWN
149 Hyfl I GIPCGESCVFIPCISGVIGCSCKSKVCYRN
150 Hyfl J GIACGESCAYFGCWIPGCSCRNKVCYFN
151 Hyfl K GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
152 Hyfl L GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
153 Hyfl M GNIPCGESCIFFPCFNPGCSCKDNLCYYN
1318 Hyla-br1 GVIPCGESCVFIPCISSFLGCSCKNKVCYRN
43 Hypa A GIPCAESCVYIPCTITALLGCSCKNKVCYN
1 kalata B1 GLPVCGETCVGGTCNTPGCTCSWPVCTRN
246 kalata B10 GLPTCGETCFGGTCNTPGCSCSSWPICTRD
247 kalata B10 linear GLPTCGETCFGGTCNTPGCSCSSWPICTRD
249 kalata B11 GLPVCGETCFGGTCNTPGCSCTDPICTRD
250 kalata B12 GSLCGDTCFVLGCNDSSCSCNYPICVKD
251 kalata B13 GLPVCGETCFGGTCNTPGCACDPWPVCTRD
252 kalata B14 GLPVCGESCFGGTCNTPGCACDPWPVCTRD
253 kalata B15 GLPVCGESCFGGSCYTPGCSCTWPICTRD
254 kalata B16 GIPCAESCVYIPCTITALLGCKCQDKVCYD
255 kalata B17 GIPCAESCVYIPCTITALLGCKCKDQVCYN
344 kalata B18 GVPCAESCVYIPCISTVLGCSCSNQVCYRN
563 kalata B19 GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
4 kalata B2 GLPVCGETCFGGTCNTPGCSCTWPICTRD
25 kalata B3 GLPTCGETCFGGTCNTPGCTCDPWPICTRD
30 kalata B4 GLPVCGETCVGGTCNTPGCTCSWPVCTRD
59 kalata B5 GTPCGESCVYIPCISGVIGCSCTDKVCYLN
24 kalata B6 GLPTCGETCFGGTCNTPGCSCSSWPICTRN
26 kalata B7 GLPVCGETCTLGTCYTQGCTCSWPICKRN
168 kalata B8 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
244 kalata B9 GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
245 kalata B9 linear GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
37 kalata S GLPVCGETCVGGTCNTPGCSCSWPVCTRN
1171 Ltri A GVACGESCVYLPCFTVGCTCTSSQCFKN
1172 Mang A GFPTCGETCTLGTCNTPGCTCSWPICTRD
1173 Mden A GIPTCGETCTLGTCNTPGCTCSWPICTKN
1174 Mden B GLPICGETCFTGKCYTPGCTCSYPICKKN
1175 Mden C GKPICGETCFKGKCYTPGCTCSYPVCKKN
1176 Mden E GIPCGESCVYIPCITAAIGCSCKSKVCYRN
1177 Mden F GLPICGETCFFGKCNTPKCTCINPICYKN
1178 Mden G GIPCAESCVYIPCITAALGCSCKNKVCYRN
1179 Mden H GIPICGETCFFGKCNTPKCTCNKPLCYKN
1180 Mden I GIPCGESCVYIPCITTAIGCSCKNKVCYRN
1181 Mden J GSIPCGESCVYIPCISSIVGCACKSKVCYKN
1182 Mden K GSIPCGESCVWIPCISSVVGCACKNKVCYKN
1183 Mden L GSIPCGESCVYIPISAVLGCSCKNKVCYRN
1184 Mden M GTIPCGESCVYIPCITSALGCSCKKKVCYKN
1185 Mden N GTIPCGESCVYIPCLTSALGCSCKNKVCYRN
1013 mech 1 GVIPCGESCVFIPCINKKKCSCKNKVCYRD
1014 mech 2 GLPTCGETCTLGKCNTPKCTCNWPICYKD
1015 mech 3 GLPTCGETCTLGKCNTPKCTCNWPICYKN
1016 mech 4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKD
1017 mech 5 GVIPCGESCVFIPCISSVVGCTCKNKVCYRD
1018 mech 6 GVIPCGESCVFIPCISSVVGCTCKNKVCYRN
1019 mech 7 GIPICGETCTIGTCNTPGCTCSWPVCTRD
1020 mela 1 GKYTCGETCFKGKCYTPGCTCSYPICKKD
1021 mela 2 GKPTCGETCFKGKCYTPGCTCSYPLCKKD
1022 mela 3 GKPICGETCFKGKCYTPGCTCSYPICKKD
1023 mela 4 GKPICGETCFKGKCYTPGCTCSYPICKKN
1024 mela 5 GSAIACGESCFKFKCYTPGCSCSYPICKKD
1025 mela 6 GIPTCGETCFKGKCYTPGCSCSYPICKKD
1026 mela 7 GLPTCGETCFKGKCYTPGCSCSYPICKKN
1298 Mema A GLPCAESCVWLPCTVTALLGCSCKDKVCYRN
1299 Mema B GTVPCGESCVWLPCLTGLVGCSCKNNVCYTN
1186 Mobo A GFPTCGETCTLGTCNTPGCTCSWPICTRN
1187 Mobo B GKPICGETCAKGKCYTPKCTCNWPICYKN
1130 Mra1 GIPCAESCVYIPCLTSIGCSCKSKVCYRN
390 Mra13 GIPCGESCVYLPCFTTIIGCKCQGKVCYH
392 Mra14a GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
393 Mra14b GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
397 Mra17a GSIPCGESCVYIPCISSLLGCSCESKVCYKN
1131 Mra2 GIPCAESCVYIPCLTSAGCSCKSKVCYRN
405 Mra22 GVPCGESCVWIPCLTSIVGCSCKNNVCTLNS
407 Mra23 GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
409 Mra24 GHPTCGETCLLGTCYTPGCTCKRPVCYKN
411 Mra25 GSAILCGESCTLGECYTPGCTCSWPICTKN
413 Mra26 GHPICGETCVGNKCYTPGCTCTWPVCYRN
399 Mra29 GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
1132 Mra3 GSIPCGESCVYIPCITSIVGCSCKSKVCYKN
400 Mra30 GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
417 Mra30a GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
388 Mra4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKN
389 Mra5 GIPCAESCVYIPCLTSAIGCSCKSKVCYRN
1152 NorA GVIPCGESCVFIPCISTLIGCSCKNKVCYRN
576 Oak6 cyclotide 1 GLPVCGETCFGGTCNTPGCACDPWPVCTRN
573 Oak6 cyclotide 2 GLPICGETCFGGTCNTPGCICDPWPVCTRD
574 Oak7 cyclotide GSHCGETCFFFGCYKPGCSCDELRQCYKN
575 Oak8 cyclotide GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
1301 Orto A GLPCGESCVYLPCLLTAPLGCSCKNKVCYRN
1188 Pali A GSIPCGESCVFIPCISGLAGCSCKNRVCYLN
5 palicourein GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
814 paltet 1 GLPICGETCFTGTCNTPGCTCSYPVCTRN
771 Panitide L1 QLPICGETCVLGTCYTPGCRCQYPICVR
772 Panitide L2 QLPICGETCVLGRCYTPNCRCQYPICVR
778 Panitide L3 QAFCGETCLLGKCYTPGCSCHTGICLK
774 Panitide L4 QAFCGETCLLGTCYTPGCRCTAGICLK
779 Panitide L5 QLPICGETCVLGTCYTPGCSCAYPICAR
776 Panitide L6 QLPICGETCVLGTCYTPGCSCAYPICVR
780 Panitide L7 QAFCGETCVLGTCYTPGCSCNFGICLK
781 Panitide L8 QDCGETCVLGTCYTPGCSCSAYPLCV
744 Parigidin-br1 GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
1316 Parigidin-br2 GGSVPCGESCVFIPCLTSLAGCSCKNKVCYYN
1313 Parigidin-br3 PSPCGESCVFIPCISALIGCSCKNKVCYR
1673 pase A GLPVCGETCVGGTCNTPGCVCSWPVCTRN
1674 pase B GLPVCGETCVGGTCNTPGCVCSWPICTRN
1675 pase C GLPTCGETCVGGTCNTPGCVCSWPICTRN
1676 pase D GLPVCGETCVGGTCNTPGCVCAWPICTRN
1677 pase E GLPVCGETCVTGSCYTPGCSCSWPVCKRN
877 Phyb A GIGCGESCVWIPCVSAAIGCSCSNKICYRN
909 Phyb B GVPCGESCVWMYCISAAMGCSCRNKVCYRN
911 Phyb C GIPCGESCVWMYCITATMGCSCRNKVCYKN
878 Phyb D GIPCGESCMWIPCISAAIGCSCTNHVCYKN
879 Phyb E GIPCGESCVWIPCISGVQGCSCSNKICYRN
880 Phyb F GIPCGGSCVWIPCISGVQGCSCSNKICYRN
881 Phyb G GIPCGESCAWIPCISAVQGCSCRNKICYRN
882 Phyb H GLPCGESCIWIECISGAIGCSCRNKVCYRN
883 Phyb I GIPCGESCIWIPCTTTALLGCSCSNKVCYKN
884 Phyb J SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
885 Phyb K STDCGEPCVYIPCTITALLGCSCLNKVCVRP
886 Phyb L QSISCAETCVWIPCATSLIGCSCVNSICTYTN
1153 Poca A GLPCAESCVFIPCTITAILGCSCRDRVCYD
1154 Poca B GIPCAESCVFIPCVTAILGCSCKDRVCYN
345 PS-1 GFIPCGETCIWDKTCHAAGCSCSVANICVRN
813 psybra 1 GLPICGETCTLGTCNTPGCTCSWPICTKN
1200 psybry A GFNPCGETCIWFPTCHAPGCTCSIANICVRN
1201 psybry B GFNPCGETCWNKPTCHAPGCTCSIANICVRN
1202 psybry C GFNPCGETCQIDQTCHAPGCTCSIANICVRN
552 psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN
553 psyle B GIPCGETCVAFGCWIPGCSCKDKLCYYD
554 psyle C KLCGETCFKFKCYTPGCSCSYPFCK
555 psyle D GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
556 psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
557 psyle F GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
1195 psyleio A GLPICGETCFTGTCNTPGCSCTYPICTRD
1196 psyleio B GDLPICGETCFGGTCNTPGCVCAWPVCNR
1198 psyleio C GDLPVCGETCFGGTCNTPGCVCAWPVCTR
1199 psyleio D GLPVCGESCFGGTCNTPGCSCTWPVCTRD
1197 psyleio E SVTPIVCGETCFGGTCNTPGCSCSWPICTK
817 psypoe 1 GSVICGETCFTTVCNTPGCYCGAYXCTRN
1151 Psysol 2 GLPICGESCVGGTCNTPGCTCTWPVCTRN
1638 ribe1 AIPCGESCVYLPCFTKVFKCKCKNKVCYR
1647 ribe10 AIPCGESCVYIPCISQVIGCKCKNKVCYR
1648 ribe11 IPCGESCVFIPCISQVVGCKCKNKVCYR
1649 ribe12 AIPCGESCVFIPCISQVVGCKCKNKVCYR
1650 ribe13 AIPCGESCVWIPCISAAIGCSCKNKVCYR
1652 ribe14 VIPCGESCVYIPCISTVIGCSCQNKVCYRN
1653 ribe15 AIPCGESCVWIPCISSVVGCKCKNKVCYR
1654 ribe16 AIPCGESCVWIPCISAAIGCSCRSKVCYR
1655 ribe17 IPCGESCVYIPCLTAAIGCSCKNKVCYR
1656 ribe18 IPCGESCVYIPCISKVIGCSCKNKVCYR
1657 ribe19 ZLPCGESCVWIPCISSVIGCSCRNKVCYR
1639 ribe2 PCGESCVYLPCFTKVFKCKCKNKVCYR
1658 ribe20 FQCGESCGMITTYCFTSVIGCSCKGRVCVR
1659 ribe21 AIPCGESCVYIPCISAVIGCKCQNKVCYR
1660 ribe22 AIPCGESCVYIPCISSVLGCSCKNKVCYR
1662 ribe23 AIPCGESCVFIPCISSVIGCSCKNKVCYR
1663 ribe24 AIPCGESCVYIPCLTAAIGCSCKNKVCYR
1664 ribe25 ZLPCGESCVWIPCISSVIGCSCRNKVCYR
1665 ribe26 AIPCGESCVYIPCISKVIGCSCKNKVCYR
1666 ribe27 ETPCGESCVWIPCLTGVIGCSCRNKVCYM
1667 ribe28 VPCGESCVFLGCFIPGCSCKNKVCYF
1668 ribe29 ZLPCGESCVWIPCISSVIGCSCRNKVCYR
1640 ribe3 IPCGESCVYIPCLTSVIKCKCKNKVCYR
1670 ribe30 AIPCGETCVILGCFIPGCKCKNKVCYF
1637 ribe31 AIPCGESCVYIPCISVVIGCSCRNKVCYR
1671 ribe32 AVPCGESCVFLGCFIPGCSCKNKVCYF
1672 ribe33 GIPCGESCVYIPCTVTALLGCSCQDKVCYKN
1641 ribe4 AIPCGESCVYIPCLTSVIKCKCKNKVCYR
1642 ribe5 AIPCGESCVYIPCISKILGCSCKNKVCYR
1643 ribe6 QQYCGESCYVLPCFTQGCHCVSGQCVRDN
1644 ribe7 IPCGESCVWIPCLTSVFKCKCKNKVCYR
1645 ribe8 IPCGESCVYIPCISQVIGCKCKNKVCYR
1646 ribe9 AIPCGESCVWIPCISKVIGCSCKNKVCYR
985 riden A GLPVCGETCVGGTCNTPGCTCTWPVCTRN
1303 Rigra A GVPCGESCVWLPCTVTALLGCKCETRGCTLN
1304 Rili A GLPCAESCVWLPCTVTALLGCTCVDRVCFLD
1305 Rili B GLPVCGETCAGGTCNTPGCSCTWPLCTRN
1308 Rivi1 GLPICGETCVFGKCNTPGCSCRRPICYKN
1309 Rivi2 GSYLCGETCVQGKCYTPGCTCSWPICKKN
1310 Rivi3 GLPICGETCLLGKCYTPGCSCRRPVCYKN
1311 Rivi4 GKPICGETCLLGKCYTPGCTCGKRVLCYKN
1312 Rivi5 GLPICGETCTLGTCNTPGCTCSWPVCFRN
7 tricyclon A GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN
167 tricyclon B GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN
558 vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN
559 vaby B GLPVCGETCAGGTCNTPGCSCTWPICTRN
560 vaby C GLPVCGETCAGGRCNTPGCSCSWPVCTRN
561 vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
562 vaby E GLPVCGETCFGGTCNTPGCSCDPWPVCTRN
61 varv peptide B GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
62 varv peptide C GVPICGETCVGGTCNTPGCSCSWPVCTRN
63 varv peptide D GLPICGETCVGGSCNTPGCSCSWPVCTRN
64 varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN
65 varv peptide G GVPVCGETCFGGTCNTPGCSCDPWPVCSRN
66 varv peptide H GLPVCGETCFGGTCNTPGCSCETWPVCSRN
1189 Vdif A GIPCGESCVFIPCISSVVGCSCKSKVCYRN
86 vhl-1 SISCGESCAMISFCFTEVIGCSCKNKVCYLN
138 vhl-2 GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
6 vhr1 GIPCAESCVWIPCTVTALLGCSCSNKVCYN
1601 viar 1 GIPCGESCVYIPCITAALGCSCKSKVCYRN
1602 viar 2 GTIPCGESCVFIPCISSVLGCSCKSKVCYKN
425 Viba 1 GIPCGEGCVYLPCFTAPLGCSCSSKVCYRN
377 Viba 10 GIPCAESCVYLPCVTIVIGCSCKDKVCYN
443 Viba 11 GIPCGESCVWIPCISGAIGCSCKSKVCYRN
378 Viba 12 GIPCAESCVWIPCTVTALLGCSCKDKVCYN
447 Viba 13 TIPCAESCVWIPCTVTALLGCSCKDKVCYN
379 Viba 14 GRLCGERCVIERTRAWCRTVGCICSLHTLECVRN
386 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN
384 Viba 17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN
375 Viba 2 GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
428 Viba 3 GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
964 viba 30 linear GPPVCGETCVGGTCNTPGCSCSWPVCTRN
965 viba 32 GLPVCGEACVGGTCNTPGCSCSWPVCTRN
430 Viba 4 GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
376 Viba 5 GIPCGESCVWIPCLTATIGCSCKSKVCYRN
433 Viba 6 GIPCGESCVLIPCISSVIGCSCKSKVCYRN
436 Viba 7 GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
439 Viba 8 GAGCIETCYTFPCISEMINCSCKNSRCQKN
440 Viba 9 GIPCGESCVWIPCISSAIGCSCKNKVCYRK
1254 Viba18 GIHCAETCLWGTCRTAYIGCSCENKICYKN
1255 Viba19 GLPVCGETCFGGTCNTPGCSCEWPVCTRN
1256 Viba20 PISCGETCKFSRCFTSIFGCKCINKVCHT
1257 Viba21 GLFCGEYCVQFPCRSPGCICLRGLCVRN
1258 Viba22 GIPCGESCVFIPCISSVIGCSCKSKVCYRN
1259 Viba23 GIPCGESCVWIPCFSAAIGCSCSSKVCYRN
1260 Viba24 GKIPCGESCVWIPCITTVVGCSCSNKVCYKN
1261 Viba25 GRVPCGESCVYIPCFTSIAGCSCSDKVCWHN
1262 Viba26 GFPCGESCVYVPCLTAAIGCSCKNKVCYKN
1263 Viba27 GVQCGPTCRFGPVNCGINPRCNCRNTRCVWD
1264 Viba28 GIHCAETCIWGTCRTAIIGCSCENRICYKN
1265 Viba29 GLPVCGETCVGGTCSTPGCGCSWPVCTRN
1266 Viba30 GPPVCGETCVGGTCNTPGCSCSWPVCTRN
1267 Viba31 GLPVCGETCVGGACNTPGCACSWPVCTRN
1268 Viba32 GLPVCGEACVGGTCNTPGCSCSWPVCTRN
1269 Viba33 GLPVCGETCFGGTCNTPGCPCEWPVCTRN
1270 Viba34 GSIPSCGESCFKGKCYTPGCSCSKYPLCAKN
1271 Viba35 GQDFCGGQICFASDCIVVGCECDAWSRCVPS
1272 Viba36 GSYYSCGETCRKTKCYTPDCICAWPGLCGKN
1273 Viba37 GIPCAESCVYLPCVTIVIGCSCKDEVCYNS
1274 Viba38 GSIPSCGESCFKGKCYTPGCSCSKYPLCAKK
1275 Viba39 GSIPSCGESCFKGKCYTPGCSCSKYPLCAYE
1276 Viba40 GIPCGESCVWIPCITAAIGCSCSSKVCYRN
1277 Viba41 GSIPSCGESCFKGKCYTPVCSCSKYPLCAKN
1278 Viba42 GASCVETCNYFPCISEMINCYCQSKRCVKN
1279 Viba43 GSLPCGESCVFIPCISSVIGCACKSKVCYKN
1280 Viba44 GIHCAETCFWGTCRTAYIGCSCENRICYKN
1693 vibe 1 GIPCGESCVWIPCITSAIGCSCSSKVCYRN
1699 vibe 10 GIPCGESCAYAPCFTSLISCTCSRKGCYH
1700 vibe 11 GAFCFETCVFLPCFSSGIGCYCAWHYCVQD
1701 vibe 12 GVACGESCIIRPCIFTAILGCRCRFTVCVN
1702 vibe 13 GLPVCGETCVGGSCYTPGCTCSWPVCTRN
1703 vibe 14 GVPICGESCFKGACYTPGCTCNWPVCERN
1705 vibe 15 GSYISCGETCVKLKCYTPGCKCTWPACKKN
1706 vibe 16 ASSTCGKTCFGGICNTPGCSCSSWPMCMKN
1707 vibe 17 GIVYCGETCGGTRCYTPGCSCRYPYCSKN
1708 vibe 18 GSIFNCGETCVFGTCYTPGCSCVYGACSKD
1709 vibe 19 GDRAVCGETCFTGICYTPICVCGKWDLCRMN
1694 vibe 2 GIPCGESCVWIPCLTSAIGCSCSSKVCYKN
1710 vibe 20 GDYYACRESCHKTKCHTPGCICGWPGLCAKN
1711 vibe 21 GLNCGESCWGFHCDRHDCTCGLTWPYCSKN
1712 vibe 22 GSFSRCSGSCRNTPCPPGCFCTTRFTCI
1713 vibe 23 GTIFDCGETCALGTCYTPHCSCGKFFLCYGTD
1714 vibe 24 GTIFDCGETCFLGKCYTPGCSCGEYKVCYGTN
1715 vibe 25 GYNCGETCWGFHCDRDDCSCGLTWPYCSKN
1695 vibe 3 GTFPCGESCVFIPCISSVVGCSCKSKVCYKN
1696 vibe 4 GFPCGESCVYIPCLTAAIGCSCKNKVCYKN
1697 vibe 6 GSVPCGESCVWIPCISSVVGCSCSNKVCYMN
1698 vibe 7 GLKAAVPCGESCVWIPCVTSVVGCSCSNKVCYN
352 vibi A GLPVCGETCFGGTCNTPGCSCSYPICTRN
353 vibi B GLPVCGETCFGGTCNTPGCTCSYPICTRN
354 vibi C GLPVCGETCAFGSCYTPGCSCSWPVCTRN
355 vibi D GLPVCGETCFGGRCNTPGCTCSYPICTRN
356 vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN
357 vibi F GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
358 vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
359 vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
360 vibi I GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
361 vibi J GTFPCGESCVWIPCISKVIGCACKSKVCYKN
362 vibi K GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
35 vico A GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
41 vico B GSIPCAESCVYIPCITGIAGCSCKNKVCYYN
1306 Vide A GLPCGESCVFLPCLTSALGCSCKSKVCYRN
782 vigno 1 GLPLCGETCAGGTCNTPGCSCSWPVCVRN
791 vigno 10 GTIPCGESCVWIPCISSVVGCSCKSKVCYKD
783 vigno 2 GSSPLCGETCAGGTCNTPGCSCSWPVCVRD
784 vigno 3 GLPLCGETCVGGTCNTPGCSCSWPVCTRN
785 vigno 4 GLPLCGETCVGGTCNTPACSCSWPVCTRN
786 vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN
787 vigno 6 GIPCGESCVWIPCISSAIGCSCKGSKVCYRN
788 vigno 7 GTLPCGESCVWIPCISSVVGCSCKNKVCYKN
789 vigno 8 GIPCGESCVWIPCITSAVGCSCKSKVCYRN
790 vigno 9 GIPCGESCVWIPCISSALGCSCKSKVCYRN
1157 vila A GIPCGESCVWIPCISSAIGCSCKDKVCYRD
1158 vila B GIPCGESCVWIPCISSAIGCSCRSKVCYRD
1159 vila C GTLPCGESCVWIPCISSVVGCSCKDKVCYKD
1160 vila D GIPVCGETCAFGTCYTGGCSCSWPVCTRN
1190 Vinc A GIPVCGETCTLGTCYTAGCSCSWPVCTRN
1191 Vinc B GSIPACGESCFKGKCYTPGCTCSKYPLCAKN
1307 Vini A GSVPCGESCVWLPCLSGLAGCSCKNKVCYYD
172 violacin A SAISCGETCFKFKCYTPRCSCSYPVCK
72 violapeptide 1 GLPVCGETCVGGTCNTPGCSCSRPVCTXN
748 viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN
749 viphi B GLPVCGETCTIGTCYTAGCTCSWPICTRN
750 viphi C GVPCGESCVYIPCITSVIGCSCSSKVCYIN
751 viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN
752 viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
753 viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
754 viphi G GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
755 viphi H GIPCAESCVWIPCTVTAIVGCSCSWGVCYN
1319 Visu 1 GLPVCGETCVGGTCNTPGCTCTWPVCTRN
1320 Visu 2 GIPCAESCVYIPCTITALLGCSCKSKVCYN
1603 vito 1 GIPCGESCVFIPCISSVLGCSCKSKVCYRN
1604 vito 2 GVIPCGESCVFIPCISTLLGCSCKSKVCYRN
938 vitri 1 GLIPCGESCVWIPCISSVIGCSCKSKVCYKN
1725 vitri 10 GVPCGESCNVIPCIASLSCRCKSKVCFQN
1790 vitri 11 GKSGSCGESCYKTTCSSSFYGCSCNPVNSWCWQN
1726 vitri 12 GVTCRETCYSQDCYSAWAGCKCNDGACFIN
1727 vitri 13 GPPCGDTCVFDPCLVSAPCKCKNRVCYRN
944 vitri 14 GSSCGETCEVFSCFITRCACIDGLCYRN
1734 vitri 15 GEVPCIETCFITECFGFYYGCTCQSGLCKKKK
1730 vitri 16 GVNAHCYESCYVIPCLTEIVGCACRGNVCRPK
945 vitri 17 GSDDQVACGESCAMTPCFMHVVGCVCSQKVCYR
946 vitri 18a GVPICGETCFQGTCNTPGCTCKWPICERN
963 vitri 18b GSVFNCGETCVFGTCFTSGCSCVYRVCSKD
1735 vitri 19 GRFSCGETCFTSACHFRDIGCQCVNSQCSR
939 vitri 2 GSIPCGESCVWIPCISGIAGCSCSNKVCYLN
947 vitri 20 GDLVPCGESCVYIPCLTTVLGCSCSENVCYRN
948 vitri 21 GGPLDCQETCTLSDRCYTKGCTCNWPICYKN
949 vitri 22a GAPVCGETCFTGLCYSSGCSCIYPVCNRN
952 vitri 23 GLPTCGETCTLGTCYTPGCTCSWPLCTKN
953 vitri 24 GEPVCGDSCVFFGCDDEGCTCGPWSLCYRN
1736 vitri 25 GRSCRETCIYTSCFVTGCKCDDGACIR
1737 vitri 26 GRNCGETCAFIPCISWGCSCEFRGALKYCFKN
954 vitri 27a GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
955 vitri 29 GVPSSDCLETCFGGKCNAHRCTCSQWPLCAKN
940 vitri 3 GSWPCGESCVYIPCITSIAGCECSKNVCYKN
956 vitri 30 GFACGETCIFTSCFITGCTCNSSLCFRN
1739 vitri 31 GVLCAESCTFTSCFLTGCTCERNFCFRN
1740 vitri 32 GSCGETCKYFGCYSMIVGCKCNRNKMCYK
1741 vitri 33 GYTCIETCIIWDCESSIYGCSCQSGLCKMAK
1742 vitri 34 GINLFCLETCFFMPCLSEIIGCSCYRGGCYIIY
1743 vitri 35 GKPFCGELCSRFICYHEDCTCEWPVCTK
957 vitri 36 GGTIFSCGESCFQGTCYTKGCACGDWKLCYGEN
958 vitri 38 GDTCYETCFTGFCFIGGCKCDFPVCVKN
959 vitri 39 GAPICGESCFTGTCYTVQCSCSWPVCTRN
941 vitri 4 GTPCGESCIYVPCISAVFGCWCQSKVCYKD
1744 vitri 40 GFPYVSCGETCLLGECYTEGCFCGVSICYREE
1745 vitri 41 GCGGETCLQGKCFANDCICDWPYCKK
961 vitri 42a GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
1746 vitri 43 GLNCGETCWGFSCDRDDCSCGFTWPYCSKN
1747 vitri 44 GLNCGETCWGFSCDRDDCSCGFTWPYCSKN
1748 vitri 45 GLNCGETCWGFTCNRADCSCGFTYPYCSKN
1749 vitri 46 GVYCGETCKYTACRTIGCSCNSNQMCYK
1750 vitri 47 GKFCFETCRSSGCASGTFGCSCEGTMCRGN
1751 vitri 48 GYSGGCGETCFHKPCASMAYGCSCKDGACST
1752 vitri 49 GDACGDTCVFFGCDDPGCTCGVLSICYRN
1718 vitri 5 GIPCAESCVWIPCTVTALVGCSCSEKVCYYN
962 vitri 50 GDIPCGESCVYIPCITGVLGCSCSHNVCYYN
1753 vitri 51 GYSGGCGETCVTVRCFTFPLCTCKNGKCTK
1754 vitri 52 GLIPCGESCAWFPFCFTETIGCSCQNKICYFM
1719 vitri 6 GHYCGETCFFIPCASSLIDCECHNDYCYRN
942 vitri 8 PTPCGETCIWISCVTAAIGCYCHESICYR
1766 vitri 94a GLPVCGESCVGGTCNTPGCSCTWPLCTRN
951 vitri 94b GVAVCGETCTLGTCYTPGCSCDWPICKRN
1768 vitri 96 GEICGRVQWCNSKSPCPAGCYCSYSGHCVKN
1769 vitri 98 GIPCGETCVFSGCYSVTFGCACEKRVCYKN
1770 vitri 99 GFVHDPNFLNCGETCWGGTCNSVGCSCGFSWPYCTKN
943 vitri 9a GTIFDCGETCLLGKCYTPGCSCGSWALCYGQN
36 vitri A GIPCGESCVWIPCITSAIGCSCKSKVCYRN
601 vitri B GYPICGESCVGGTCNTPGCSCSWPVCTTN
602 vitri C GLPICGETCVGGTCNTPGCFCTWPVCTRN
603 vitri D GLPVCGETCFTGSCYTPGCSCNWPVCNRN
604 vitri E GLPVCGETCVGGTCNTPGCSCSWPVCFRN
605 vitri F GTLPCGESCVWIPCISSVVGCACKSKVCYKD
1281 ViulA GIPCGESCVWIPCISSLIGCSCRGKVCYH
1282 ViulB GVPCGESCVWIPCLTGAIGCSCSNKVCYLN
1283 ViulC GTFCGETCVMFPCFSSARGCGCHNLGCELN
1284 ViulD GIPCGESCVWIPCLTSAIGCSCKSKVCYKN
1285 ViulE GGHCGESCMLLPCFTARIGCSCSRSICYKN
1286 ViulF GRFCGEICSRGFCSNPRCTCNASRQCVRN
1287 ViulG GRAVCGETCFAGICYTPVCVCGKWDLCRMN
1288 ViulH SELPCGESCVFIPCITSIAGCSCSHKVCYLN
1289 ViulI GPTPCGETCIWISCVTAVMGCSCKNSICYMN
1290 ViulJ GEVTCNGETCFTGKCNAKGCNCKNWPLCTRN
1291 ViulK SIFCSETCRTFPCFTKAVGCSCVSKRCYKN
1292 ViulL GIPCAETCLWRPCRTAIMGCSCEYNFCYKN
922 vocC GLPVCGETCVGGTCNTPGCSCSWPVCIRN
1252 Vodo I2 GVFCGELCIKASCSIPGCECIAGLCYKN
1253 Vodo I3 GVFCGEPCIKASCSIPGCECIAGLCYKN
452 Vodo L1 GLPICGETCTLGTCYTVGCTCSWPICTRN
1251 Vodo l1 GVFCGEACAQASCSIAGCECIAGLCYKN
1687 Vodo L11 GSIPCGESCVFIPCISSIVGCSCKSKVCYR
1688 Vodo L12 GVPCGESCVWVPCTVTALMGCSCVREVCRIS
1689 Vodo L13 GAIYCGESCVLIPCISSVIGCRCENKVCVHR
1691 Vodo L18 GSVIKCGESCLLGKCYTPGCTCSRPICKGK
1692 Vodo L19 GHPDGAVPCFESCVFVPCISSVVGCRCENNVCVK
1679 Vodo L2 ALPVCGETCVGGTCNTPGCSCSWPVCTRN
1680 Vodo L3 SKDNCGESCFAGKCYTPGCTCEYPICMNN
1682 Vodo L5 GTIPCGESCVFIPCLTSAIGCSCKKVCYKN
1683 Vodo L6 GIPCGESCVWIPCITGTIGCSCKSKVCYTN
1684 Vodo L7 GIPCGESCVFIPCISSIVGCSCKSKVCYKN
1685 Vodo L9 GSIPCGESCVFIPCLTSAIGCSCKSKVCYRN
31 vodo M GAPICGESCFTGKCYTVQCSCSWPVCTRN
40 vodo N GLPVCGETCTLGKCYTAGCSCSWPVCYRN
503 Vpf-1 GIPCGESCVFIPCLTAAIGCSCRSKVCYRN
502 Vpl-1 GSQSCGESCVLIPCISGVIGCSCSSMICYFN
1192 Vpub A GVIPCGESCVFIPCISAVIGCSCKSKVCYRN
1193 Vpub B GIIPCGESCVFIPCITSVVGCSCKSKVCYKN
1194 Vpub C GIIPCGESCVFIPCITSIVGCSCKSKVCYKN