Cter 5(990) Protein Card

General Information
Name Cter 5
Alternative name(s) Vodo L4,Vodo P3
Sequence GGEFLKCGESCVQGECYTPGCSCDYPICKNN
Class Cyclotide
Technique MS,NGS
Average Mass 3281.64
Monoisotopic Mass 3279.25
m/z M+H 3281.64
ProteinType Wild type
Parent
Organism Viola odorata
Clitoria ternatea L
Notes Cter 5 was initially published with only one Gly residue in Loop 6 from a prediction made from the precursor sequence. MS data from Aslam et al. (2021) proves that the precursor processing is different and that Loop 6 has two Gly residues. This cyclotide also found in the petiole tissue of V. odorata by Aslam et al.(2022) using UPLC-Q-TOF/MS and LC-MS/MS analysis.
Cyclic Yes

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0
Aslam,L., Kaur,R., Hussain,S., Kapoor,N., and Mahajan,R. (2022) LC-MS/MS identification and structural characterization of isolated cyclotides from precursor sequences of Viola odorata L. petiole tissue using computational approach. J Biosci 47:50-0

Cross-references
Protein precursor(s) Cter 5 precursor (partial)
prcVodo P10 [partial]
prcVodo P10 [partial]
prcVodo P10 [partial]
Nucleic acids Cter 5 mRNA partial
Structure
Links GenBank ALL96772.1
SwissProt A0A0S1RSJ8

Tools