Cter 4(989) Protein Card

General Information
Name Cter 4
Alternative name(s) cT39,ctr pep 10
Sequence GDPLACGETCFGGTCYTPGCVCDPWPICTKN
Class Cyclotide
Technique NGS
Average Mass 3185.60
Monoisotopic Mass 3183.24
m/z M+H 3185.6
ProteinType Wild type
Parent
Organism Viola odorata
Clitoria ternatea L
Notes Was detected in <i>C. ternatea</i> pod by NGS and MS (Kalmankar et al., 2020) Cter 4 was also found in the petiole tissue of Viola odorata by Aslam et al.(2022) using UPLC-Q-TOF/MS and LC-MS/MS analysis.
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0
Aslam,L., Kaur,R., Hussain,S., Kapoor,N., and Mahajan,R. (2022) LC-MS/MS identification and structural characterization of isolated cyclotides from precursor sequences of Viola odorata L. petiole tissue using computational approach. J Biosci 47:50-0

Cross-references
Protein precursor(s) Cter 4 precursor (partial)
Cter 4 precursor [partial]
Nucleic acids Cter 4 mRNA (partial)
Structure
Links GenBank ALL96771.1
SwissProt A0A0S1RGB4

Tools