cliotide T11(978) Protein Card

General Information
Name cliotide T11
Alternative name(s) Cter 21,ctr pep 39
Sequence GIPCGESCVFIPCTITALLGCSCKDKVCYKN
Class Cyclotide
Technique MS,NGS,Amino acid analysis
Average Mass 3242.86
Monoisotopic Mass 3240.46
m/z M+H 3242.86
ProteinType Wild type
Parent
Organism Viola odorata
Clitoria ternatea L
Notes <p>Highly expressed in C. ternatea root. (Gilding et al., 2016).</p> <p> Was detected in <i> C. ternatea pod by NGS and in <i> C. ternatea leaf and flower by MS (Kalmankar et al., 2020).</p>
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) cliotide T11 precursor (partial)
cliotide T11 precursor [partial]
Nucleic acids Cter 21/ cliotide T11 mRNA partial
Structure
Links GenBank ALL96753.1
SwissProt A0A0S1RQI0

Tools