Cter R(600) Protein Card

General Information
Name Cter R
Alternative name(s) cliotide T7,ctr pep 34
Sequence GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
Class Cyclotide
Technique MS,PCR,NGS
Average Mass 3228.84
Monoisotopic Mass 3226.45
m/z M+H 3228.84
ProteinType Wild type
Parent
Organism Viola odorata
Clitoria ternatea L
Notes <p>Induces upregulation of inflammatory cytokines in THP-1 cells stimulated with LPS. (Nguyen et al., 2016).</p> <p>May exist as a mature linear peptide. (Serra et al., 2016)</p> <p>Was detected in <i>C. ternatea</i> pod and stem by NGS and in <i>C. ternatea</i> pod by MS (Kalmankar et al., 2020)</p>
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) Cter R precursor
Cter R precursor
Cter R precursor
Cter R precursor
Cter R precursor [partial]
Nucleic acids
Structure
Links SwissProt P86903

Tools