Cter Q(599) Protein Card

General Information
Name Cter Q
Alternative name(s) cliotide T5
Sequence GIPCGESCVFIPCISTVIGCSCKNKVCYRN
Class Cyclotide
Technique NGS,MS,PCR,Amino acid analysis
Average Mass 3170.76
Monoisotopic Mass 3168.41
m/z M+H 3170.76
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes High general expression in C. ternatea. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter A or Cter Q precursor [partial]
Nucleic acids
Structure
Links SwissProt P86904

Tools