cycloviolacin O3(53) Protein Card

General Information
Name cycloviolacin O3
Alternative name(s) CyO3
Sequence GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
Class Cyclotide
Technique MS,EST
Average Mass 3154.72
Monoisotopic Mass 3152.38
m/z M+H 3154.72
ProteinType Wild type
Parent
Organism Viola odorata
Viola uliginosa
Notes
Cyclic Yes

Assay
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945
Insecticidal
CyO2,CyO3,CyO13,CyO19 have deterrent activity on M.persicae. [...]Dancewicz,K. et al. (2020) Journal of Insect Physiology 122:104025-0

References
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Slazak,B., Kapusta,M., Strömstedt,A.A., S?omka,A., Krychowiak,M., Shariatgorji,M., Andrén,P.E., Bohdanowicz,J., Kuta,E., and Göransson,U. (2018) How Does the Sweet Violet (Viola odorata L.) Fight Pathogens and Pests - Cyclotides as a Comprehensive Plant Host Defense System Frontiers in plant science 9:0-0
Slazak, B., Jacobsson, E., Kuta, E. and Göransson, U. (2015) Exogenous plant hormones and cyclotide expression in Viola uliginosa (Violaceae Phytochemistry 117:527-536
Dancewicz,K., Slazak,B., Kie?kiewicz,M., Kapusta,M., Bohdanowicz,J., and Gabry?,B. (2020) Behavioral and physiological effects of Viola spp. cyclotides on Myzus persicae (Sulz.) Journal of Insect Physiology 122:104025-0

Cross-references
Nucleic acids
Structure
Links GenBank P58435.1
SwissProt P58435

3D models Download or view with Jmol

Tools