Cter A(477) Protein Card

General Information
Name Cter A
Sequence GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
Class Cyclotide
Technique MS,PCR,NGS,Amino acid analysis
Average Mass 3269.89
Monoisotopic Mass 3267.48
m/z M+H 3269.89
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Clitoria ternatea L
Notes <p>May also exist as a mature linear peptide (Serra et al., 2016).</p> <p>Was detected in <i>C. ternatea</i> stem by NGS and in <i> C. ternatea pod by MS (Kalmankar et al., 2020).</p> <p><i>H. enneaspermus</i>: some proteolytic fragments from full extract were sequenced by MS/MS (ProteinPilot) (Du et al., 2020).</p>
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ (2011) Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins. ACS Chem Biol 6:345-355
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus. J Biol Chem 295:10911-10925
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) Cter A or Cter Q precursor [partial]
Cter A precursor
Cter A precursor [partial]
Nucleic acids
Structure
Links SwissProt P86841

Tools