circulin B(45) Protein Card

General Information
Name circulin B
Sequence GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
Class Cyclotide
Average Mass 3283.92
Monoisotopic Mass 3281.5
m/z M+H 3282.51
ProteinType Wild type
Parent
Organism Chassalia parvifolia
Notes
Cyclic Yes

Assay
Anti-bacterial
Kalata B1, circulin A and B and cyclopsychotride shown to possess some anti-bacterial activity. [...]Tam JP et al. (1999) Proc Natl Acad Sci U S A 96:8913-8
Hemolytic
Hemolytic activity established for kalata B1, circulin A, circulin B and cyclopsychotride A [...]Tam JP et al. (1999) Proc Natl Acad Sci U S A 96:8913-8
Anti-HIV
Circulin A and B shown to possess antiviral cytoprotective activity. [...]Gustafson KR et al. (1994) J Am Chem Soc 116:9338-8
Chemical Shift
Chemical shift data for circulin B [...]

References
Gustafson KR, Sowder RC, Henderson LE, Parsons IC, Kashman Y, Cardellina JH, McMahon JB, Buckheit RB, Pannell LK, Boyd MR (1994) Circulins A and B. Novel human immunodeficiency virus (HIV)-inhibitory macrocyclic peptides from the tropical tree Chassalia parvifolia. J Am Chem Soc 116:9338-8
Tam JP, Lu YA, Yang JL, Chiu KW (1999) An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides. Proc Natl Acad Sci U S A 96:8913-8
Tam JP, Lu YA (1998) A biomimetic strategy in the synthesis and fragmentation of cyclic protein. Protein Sci 7:1583-92
Derua R, Gustafson KR, Pannell LK (1996) Analysis of the disulfide linkage pattern in circulin A and B, HIV-inhibitory macrocyclic peptides. Biochem Biophys Res Commun 228:632-8

Cross-references
Nucleic acids
Structure Solution structure of circulin B
Links GenBank P56879.2
SwissProt P56879

Tools