Viba 11(443) Protein Card

General Information
Name Viba 11
Alternative name(s) cycloviolacin B15
Sequence GIPCGESCVWIPCISGAIGCSCKSKVCYRN
Class Cyclotide
Technique MS,NGS
Average Mass 3110.66
Monoisotopic Mass 3108.36
m/z M+H 3110.66
ProteinType Wild type
Parent
Organism Viola tricolor
Viola baoshanensis
Viola philippica
Viola betonicifolia
Notes Zhang et al 2009 published a different sequence in Table 2 (position 12 I>L) but the sequence in their Figure 1 and in GenBank (see cDNA sequence) confirm the sequence in the present card.
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32
He,W., Chan,L.Y., Zeng,G., Daly,N.L., Craik,D.J. and Tan,N. (2011) Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides 32:1719-1723
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Protein precursor(s) viba 11 precursor
Nucleic acids viba 11 precursor
Structure
Links SwissProt B5B3Y8

3D models Download or view with Jmol

Tools