Mra30(400) Protein Card

General Information
Name Mra30
Alternative name(s) Mra18b,mram 8
Sequence GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
Class Cyclotide
Technique MS,PCR,NGS
Average Mass 3115.68
Monoisotopic Mass 3113.37
m/z M+H 3115.68
ProteinType Wild type
Parent
Organism Viola odorata
Viola tricolor
Hybanthus enneaspermus
Viola baoshanensis
Melicytus ramiflorus
Viola philippica
Viola uliginosa
Viola arcuata
Notes <i>H. enneaspermus</i>: some proteolytic fragments from full extract were sequenced by MS/MS (ProteinPilot) (Du et al., 2020).
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388
He,W., Chan,L.Y., Zeng,G., Daly,N.L., Craik,D.J. and Tan,N. (2011) Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides 32:1719-1723
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862
Zhang, J., Li, J., Huang, Z., Yang, B., Zhang, X., Li, D., Craik, D.J., Baker, A.J., Shu, W. and Liao, B. (2015) Transcriptomic screening for cyclotides and other cysteine-rich proteins in the metallophyte Viola baoshanensis. Journal of plant physiology 178:17-26
Slazak, B., Jacobsson, E., Kuta, E. and Göransson, U. (2015) Exogenous plant hormones and cyclotide expression in Viola uliginosa (Violaceae Phytochemistry 117:527-536
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus. J Biol Chem 295:10911-10925
Dang,T.T., Chan,L.Y., Huang,Y.H., Nguyen,L.T.T., Kaas,Q., Huynh,T. and Craik,D.J. (2020) Exploring the Sequence Diversity of Cyclotides from Vietnamese Viola Species. J Nat Prod 83:1817-1828
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0
Aslam,L., Kaur,R., Hussain,S., Kapoor,N., and Mahajan,R. (2022) LC-MS/MS identification and structural characterization of isolated cyclotides from precursor sequences of Viola odorata L. petiole tissue using computational approach. J Biosci 47:50-0

Cross-references
Protein precursor(s) Mra18 precursor protein (partial)
Mra19 precursor protein (partial)
Mra28 precursor protein (partial)
Mra29 precursor protein (partial)
Mra30 precursor protein (partial)
prcVodo P2 [partial]
prcVodo P2 [partial]
Nucleic acids Mra19 mRNA, partial cds
Mra18 mRNA, partial cds
Mra28 mRNA, partial cds
Mra29 mRNA, partial cds
Mra30 mRNA, partial cds
Structure
Links SwissProt A9P3S0-2

3D models Download or view with Jmol

Tools