Viba 12(378) Protein Card

General Information
Name Viba 12
Alternative name(s) cycloviolacin B4
Sequence GIPCAESCVWIPCTVTALLGCSCKDKVCYN
Class Cyclotide
Technique PCR,NGS,MS
Average Mass 3153.73
Monoisotopic Mass 3151.38
m/z M+H 3153.73
ProteinType Wild type
Parent
Organism Viola baoshanensis
Viola anagae
Notes predicted from Viola baoshanensis precursor
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32
Zhang J, Shu W, Liao B (0) Identification of cadmium responsive genes in cadmium hyperaccumulating plant Viola baoshanensis :0-0
Slazak,B., Kaltenböck,K., Steffen,K., Rogala,M., Rodríguez-Rodríguez,P., Nilsson,A., Shariatgorji,R. and Göransson,U. (2021) Cyclotide host-defense tailored for species and environments in violets from the Canary Islands. Sci Rep 11:12452-0

Cross-references
Protein precursor(s) cyclotide precursor 4a
Viola baoshanensis cyclotide precursor 4
Nucleic acids Viola baoshanensis cyclotide precursor 4 mRNA
cyclotide precursor 4a mRNA
Structure
Links SwissProt Q09PF9

3D models Download or view with Jmol

Tools