vitri A(36) Protein Card

General Information
Name vitri A
Sequence GIPCGESCVWIPCITSAIGCSCKSKVCYRN
Class Cyclotide
Technique MS
Average Mass 3154.72
Monoisotopic Mass 3152.38
m/z M+H 3154.72
ProteinType Wild type
Parent
Organism Viola odorata
Viola tricolor
Viola biflora
Psychotria leptothyrsa
Notes Vitri A was also found in the petiole tissue Viola odorata by Aslam et al. (2022) using UPLC-Q-TOF/MS and LC-MS/MS analysis.
Cyclic Yes

Assay
Cancer Cell Toxicity
Vitri A, varv A and varv E shown to possess cytotoxic activity in cancer cells. [...]Svangard E et al. (2004) J Nat Prod 67:144-7

References
Svangard E, Goransson U, Hocaoglu Z, Gullbo J, Larsson R, Claeson P, Bohlin L (2004) Cytotoxic cyclotides from Viola tricolor. J Nat Prod 67:144-7
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952
Gerlach SL, Burman R, Bohlin L, Mondal D, Göransson U (2010) Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa J Nat Prod 73:1207-1213
Tang J, Wang CK, Pan X, Yan H, Zeng G, Xu W, He W, Daly NL, Craik DJ, Tan N (2010) Isolation and characterization of cytotoxic cyclotides from Viola tricolor. Peptides 31:1434-1440
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862
Aslam,L., Kaur,R., Hussain,S., Kapoor,N., and Mahajan,R. (2022) LC-MS/MS identification and structural characterization of isolated cyclotides from precursor sequences of Viola odorata L. petiole tissue using computational approach. J Biosci 47:50-0

Cross-references
Protein precursor(s) Vbc6 precursor protein (partial)
prcVodo P8 [partial]
Nucleic acids Vbc6 mRNA, partial cds
Structure
Links GenBank P83840.1
SwissProt P83840

3D models Download or view with Jmol

Tools