vibi E(356) Protein Card

General Information
Name vibi E
Sequence GIPCAESCVWIPCTVTALIGCGCSNKVCYN
Class Cyclotide
Technique PCR,Amino acid analysis,MS
Average Mass 3081.62
Monoisotopic Mass 3079.32
m/z M+H 3081.62
ProteinType Wild type
Parent
Organism Viola biflora
Notes
Cyclic Yes

Assay
Cancer Cell Toxicity
vibi D, E, G and H were analysed using fluorometric microculture cytotoxicity assay using a lymphoma cell line. The IC50 values ranged between 0.96 and 5.0 uM for vibi E, G and H, and vibi D was not cytotoxic at 30 uM. [...]Herrmann A et al. (2008) Phytochemistry 69:939-952

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Protein precursor(s) Vbc1 precursor protein (partial)
Gpc3 precursor
Nucleic acids Vbc1 mRNA, partial cds
Structure
Links SwissProt B1NRQ8

3D models Download or view with Jmol

Tools