cycloviolacin O9(34) Protein Card

General Information
Name cycloviolacin O9
Sequence GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
Class Cyclotide
Average Mass 3140.69
Monoisotopic Mass 3138.37
m/z M+H 3140.69
ProteinType Wild type
Parent
Organism Viola odorata
Viola biflora
Notes
Cyclic Yes

Assay
Cancer Cell Toxicity
Cytotoxicity of cyO2, cyO9, hyen D and kB5 and their mutants on HeLa cells. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0
Membrane Binding Assay
[I11L] mutants of cyO2, cyO9, hyen D and kalata B5 exhibited equipotent binding to the POPC/POPE(80:20) model membrane compared to their wild-type counterparts whereas the [I11G] mutants showed no binding or weak affinity to membranes. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0

References
Trabi M, Craik DJ (2004) Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1. Plant Cell 16:2204-16
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952
Huang,Y.H., Du,Q., Jiang,Z., King,G.J., Collins,B.M. and Craik,D.J. (2021) Enabling Efficient Folding and High-Resolution Crystallographic Analysis of Bracelet Cyclotides. Molecules 26:0-0

Cross-references
Protein precursor(s) Vbc5 precursor protein (partial)
Vbc5 precursor protein (partial)
Nucleic acids Vbc5 mRNA, partial cds
Structure
Links GenBank P58441.1
SwissProt P58441

3D models Download or view with Jmol

Tools