cycloviolacin O8(27) Protein Card

General Information
Name cycloviolacin O8
Alternative name(s) CyO8,Vaf/l-1
Sequence GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
Class Cyclotide
Technique MS
Average Mass 3227.81
Monoisotopic Mass 3225.42
m/z M+H 3227.81
ProteinType Wild type
Parent
Organism Viola odorata
Viola baoshanensis
Viola adunca
Viola uliginosa
Notes
Cyclic Yes

Assay
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945
Cancer Cell Toxicity
Cycloviolacin O8 showed micromolar anticancer activity against PC-3 prostate, MDA-MB-231 breast, and OVCAR-3 ovarian cancer cell lines and antifungal activity against the agricultural pathogenFusarium graminearum. [...]Parsley et al. (2018) Phytochemistry 152:61-70

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Zhang, J., Li, J., Huang, Z., Yang, B., Zhang, X., Li, D., Craik, D.J., Baker, A.J., Shu, W. and Liao, B. (2015) Transcriptomic screening for cyclotides and other cysteine-rich proteins in the metallophyte Viola baoshanensis. Journal of plant physiology 178:17-26
Slazak, B., Jacobsson, E., Kuta, E. and Göransson, U. (2015) Exogenous plant hormones and cyclotide expression in Viola uliginosa (Violaceae Phytochemistry 117:527-536
Parsley, N.C., Kirkpatrick, C.L., Crittenden, C.M., Rad, J.G., Hoskin, D.W., Brodbelt, J.S. and Hicks, L.M. (2018) PepSAVI-MS reveals anticancer and antifungal cycloviolacins in Viola odorata Phytochemistry 152:61-70

Cross-references
Protein precursor(s) cyclotide c1 precursor
Val-1
Vaf-1
Nucleic acids cyclotide c1 precursor
Structure
Links GenBank P58440.2
SwissProt P58440

3D models Download or view with Jmol

Tools