prcVodo P8 [partial](1981) Protein Card

General Information
Name prcVodo P8 [partial]
Sequence APLSNIMMENDAIVNVIANVKTVISNPVLEEALLKTNHGV
N
GIPCGESCVWIPCITSAIGCSCKSKVCYRN
SLDNTVISN
PVLEEALLKTNHGVN
GIPCGESCVWIPCITSAIGCSCKAP
LSNIM
MENDAIVNVIANVK
Class Cyclotide
ProteinType Precursor
Parent
Organism Viola odorata
Notes
Cyclic No

Assay
No assays found

References
Aslam,L., Kaur,R., Hussain,S., Kapoor,N., and Mahajan,R. (2022) LC-MS/MS identification and structural characterization of isolated cyclotides from precursor sequences of Viola odorata L. petiole tissue using computational approach. J Biosci 47:50-0

Cross-references
Domains vitri A (36)
Vodo P6 (1978)
Nucleic acids
Structure
Links

Tools