anpy C(1963) Protein Card

General Information
Name anpy C
Sequence GLPCGESCVFLPCTVTAIIGCSCKSKVCYKN
Class Cyclotide
Technique MS
Average Mass 3200.83
Monoisotopic Mass 3198.45
m/z M+H 3200.83
ProteinType Wild type
Parent
Organism Anchietea pyrifolia
Notes
Cyclic Yes

Assay
Cancer Cell Toxicity
Cytotoxic activity against human cancer cell lines of anpy A, anpy B, anpy C, cyO4 and cyO17 [...]Fernández-Bobey,A. et al. (2022) J Nat Prod :0-0
Hemolytic
The toxicity of the cyclotides (anpy A, anpy B, cyO4, and cyO17) against human red blood cells. [...]Fernández-Bobey,A. et al. (2022) J Nat Prod :0-0

References
Fernández-Bobey,A., Pinto,M., de Almeida,L.C., de Souza,B.M., Dias,N.B., de Paula-Souza,J., Cilli,E.M., Lopes,N.P., Costa-Lotufo,L.V., Palma,M.S., and da Silva Bolzani,V. (2022) Cytotoxic Cyclotides from Anchietea pyrifolia, a South American Plant Species. J Nat Prod :0-0

Cross-references
Nucleic acids
Structure
Links

Tools