[I11L, F14A]hyen D(1951) Protein Card

General Information
Name [I11L, F14A]hyen D
Sequence GFPCGESCVYLPCATAAIGCSCKSKVCYKN
Class Cyclotide
Average Mass 3079.60
Monoisotopic Mass 3077.3
m/z M+H 3079.6
ProteinType Modified Wild Type
Parent hyen D
Organism Synthetic
Notes
Cyclic Yes

Assay
Membrane Binding Assay
Membrane binding affinity of the hyen D variants [...]Du,Q. et al. (2022) J Biol Chem 298:101822-0
Cancer Cell Toxicity
Cytotoxicity of the hyen D variants. [...]Du,Q. et al. (2022) J Biol Chem 298:101822-0

References
Du,Q., Huang,Y.H., Wang,C.K. and Craik,D.J. (2022) Mutagenesis of bracelet cyclotide hyen D reveals functionally and structurally critical residues for membrane binding and cytotoxicity. J Biol Chem 298:101822-0

Cross-references
Nucleic acids
Structure
Links

Tools