[I11L]hyen D(1940) Protein Card

General Information
Name [I11L]hyen D
Sequence GFPCGESCVYLPCFTAAIGCSCKSKVCYKN
Class Cyclotide
Average Mass 3155.70
Monoisotopic Mass 3153.33
m/z M+H 3155.7
ProteinType Modified Wild Type
Parent hyen D
Organism Synthetic
Notes Du et al. (2022) reported that [I11L]hyen D displays secondary H? shifts almost identical to hyen D.
Cyclic Yes

Assay
Cancer Cell Toxicity
Cytotoxicity of the hyen D variants. [...]Du,Q. et al. (2022) J Biol Chem 298:101822-0
Cytotoxicity of cyO2, cyO9, hyen D and kB5 and their mutants on HeLa cells. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0
Membrane Binding Assay
[I11L] mutants of cyO2, cyO9, hyen D and kalata B5 exhibited equipotent binding to the POPC/POPE(80:20) model membrane compared to their wild-type counterparts whereas the [I11G] mutants showed no binding or weak affinity to membranes. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0
Membrane binding affinity of the hyen D variants [...]Du,Q. et al. (2022) J Biol Chem 298:101822-0

References
Huang,Y.H., Du,Q., Jiang,Z., King,G.J., Collins,B.M. and Craik,D.J. (2021) Enabling Efficient Folding and High-Resolution Crystallographic Analysis of Bracelet Cyclotides. Molecules 26:0-0
Du,Q., Huang,Y.H., Wang,C.K. and Craik,D.J. (2022) Mutagenesis of bracelet cyclotide hyen D reveals functionally and structurally critical residues for membrane binding and cytotoxicity. J Biol Chem 298:101822-0

Cross-references
Nucleic acids
Structure [I11L]hyen D crystal structure
Links

Tools