[I11G]cyO2(1935) Protein Card

General Information
Name [I11G]cyO2
Sequence GIPCGESCVWGPCISSAIGCSCKSKVCYRN
Class Cyclotide
Average Mass 3084.58
Monoisotopic Mass 3082.3
m/z M+H 3084.58
ProteinType Modified Wild Type
Parent cycloviolacin O2
Organism Synthetic
Notes
Cyclic Yes

Assay
Cancer Cell Toxicity
Cytotoxicity of cyO2, cyO9, hyen D and kB5 and their mutants on HeLa cells. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0
Membrane Binding Assay
[I11L] mutants of cyO2, cyO9, hyen D and kalata B5 exhibited equipotent binding to the POPC/POPE(80:20) model membrane compared to their wild-type counterparts whereas the [I11G] mutants showed no binding or weak affinity to membranes. [...]Huang,Y.H. et al. (2021) Molecules 26:0-0

References
Huang,Y.H., Du,Q., Jiang,Z., King,G.J., Collins,B.M. and Craik,D.J. (2021) Enabling Efficient Folding and High-Resolution Crystallographic Analysis of Bracelet Cyclotides. Molecules 26:0-0

Cross-references
Nucleic acids
Structure Crystal structure of [I11G]cycloviolacin O2
Links

Tools