Helianthus schweinitzii PawS1 (aPawS1)(1892) Protein Card

General Information
Name Helianthus schweinitzii PawS1 (aPawS1)
Sequence
LAILAFVEVSVS
GYKTSISTITIEDN
GRCTKSIPPICFPD

GLDNPGGC
QIRIQQLNHCQMHLTSFDYKLRMAVENPKQQH
LNLCCNQLQEVEKQCRCEAIKQVVEQAQKQLQQGQGGQQQ
VQQMVKKAQMLPNQCNLQ
CSI
Class PawS-Derived Peptides
ProteinType Precursor
Parent
Organism Helianthus schweinitzii
Notes
Cyclic No

Assay
No assays found

References
Elliott,A.G., Delay,C., Liu,H., Phua,Z., Rosengren,K.J., Benfield,A.H., Panero,J.L., Colgrave,M.L., Jayasena,A.S., Dunse,K.M., Anderson,M.A., Schilling,E.E., Ortiz-Barrientos,D. and Mylne,J.S. (2014) Evolutionary origins of a bioactive peptide buried within Preproalbumin. Plant Cell 26:981-995

Cross-references
Domains SFTI-1 (81)
Nucleic acids Helianthus schweinitzii preproalbumin PawS1 (aPawS1) gene, partial cds
Structure
Links GenBank AFQ93650

Tools