Helianthus praecox PawS1 [partial](1891) Protein Card

General Information
Name Helianthus praecox PawS1 [partial]
Sequence
LAILAFVEVSVS
GYKTSISTITIEDN
GRCTKSIPPICFPD

GLDNPEGC
QIRIQQLNHCQMHLTSFDYKLRMAVENPKQQH
HLNLCCNQLQEVEKQCQCEAIKQVVEQAQKQLQQSQGGQQ
QVQQMVKKAQMLPNQCNLQ
CSI
Class PawS-Derived Peptides
ProteinType Precursor
Parent
Organism Helianthus praecox subsp. praecox
Notes
Cyclic No

Assay
No assays found

References
Elliott,A.G., Delay,C., Liu,H., Phua,Z., Rosengren,K.J., Benfield,A.H., Panero,J.L., Colgrave,M.L., Jayasena,A.S., Dunse,K.M., Anderson,M.A., Schilling,E.E., Ortiz-Barrientos,D. and Mylne,J.S. (2014) Evolutionary origins of a bioactive peptide buried within Preproalbumin. Plant Cell 26:981-995

Cross-references
Domains SFTI-1 (81)
Nucleic acids Helianthus praecox preproalbumin PawS1 (PawS1) gene, partial cds
Structure
Links GenBank AFQ93649

Tools