MCoFx4(1884) Protein Card

General Information
Name MCoFx4
Sequence GGVCPRVGWRCRRDSDCPGACICYPTKWCGSGSD
Class Squash trypsin inhibitor
Average Mass 3643.10
Monoisotopic Mass 3640.52
m/z M+H 3643.1
ProteinType Modified Wild Type
Parent MCoTI-II
Organism Synthetic
Notes
Cyclic No

Assay
Enzyme binding affinity
Trypsin binding affinity (KD) of chemically synthesized MCoTI-II and acyclic or cyclic MCoFx1-5 [...]Liu W et al. (2021) J Am Chem Soc 143:18481-18489
Human beta-coagulation factor XIIa (FXIIa) binding affinity (KD) of chemically synthesized MCoTI-II and acyclic or cyclic MCoFx1-5 [...]Liu W et al. (2021) J Am Chem Soc 143:18481-18489
Protease inhibition
Human beta-coagulation factor XIIa (FXIIa) inhibitory activity (Ki) of chemically synthesized MCoTI-II and acyclic or cyclic MCoFx1-5 [...]Liu W et al. (2021) J Am Chem Soc 143:18481-18489

References
Liu W, de Veer SJ, Huang YH, Sengoku T, Okada C, Ogata K, Zdenek CN, Fry BG, Swedberg JE, Passioura T, Craik DJ, Suga H. (2021) An Ultrapotent and Selective Cyclic Peptide Inhibitor of Human beta-Factor XIIa in a Cyclotide Scaffold J Am Chem Soc 143:18481-18489

Cross-references
Nucleic acids
Structure
Links

Tools