vian 17 precursor(1868) Protein Card

General Information
Name vian 17 precursor
Sequence
MDAKNMFVGLVLIATFPLPSLG
TFERDVITPEAIQAILDQ
KKTNPNSNYMLSDSEDAVNALTGKIVIADN
LVFEEALKMM
RSNNVKLD
GIPCAETCLWRPCHTAIIGCSCEYNFCHKN
SL
LAN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Viola anagae
Notes
Cyclic No

Assay
No assays found

References
Slazak,B., Kaltenböck,K., Steffen,K., Rogala,M., Rodríguez-Rodríguez,P., Nilsson,A., Shariatgorji,R. and Göransson,U. (2021) Cyclotide host-defense tailored for species and environments in violets from the Canary Islands. Sci Rep 11:12452-0

Cross-references
Domains vian 17 (1855)
Nucleic acids vian 17 precursor mRNA
Structure
Links

Tools