vian 7 precursor(1863) Protein Card

General Information
Name vian 7 precursor
Sequence
MMKVFVAIVLFAAFALPAASA
SAHQDVITLQAHDELLKSG
ASTDGMTKSVISS
PLLEEALVSYSKNKLR
GLPICGETCFV
GTCYTPGCSCSWPICTKTSLEHTIFAAAN
TLLEEGVAAFA
KKGNLE
LPLCGGETCTFGTCDTPGCTCGYWPFCTKD
SVAM
CKTEL
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Viola anagae
Notes
Cyclic No

Assay
No assays found

References
Slazak,B., Kaltenböck,K., Steffen,K., Rogala,M., Rodríguez-Rodríguez,P., Nilsson,A., Shariatgorji,R. and Göransson,U. (2021) Cyclotide host-defense tailored for species and environments in violets from the Canary Islands. Sci Rep 11:12452-0

Cross-references
Domains vian 7 (1844)
Nucleic acids vian 7 precursor mRNA
Structure
Links

Tools