vibe 12 precursor(1823) Protein Card

General Information
Name vibe 12 precursor
Sequence MPHASKTAIKRVELALASTHHLIRATVVKSITNQLINII
M
ESNKKMQLVGFVLLAAFALPALA
SSFEKDVISPRAIQAVL
EKKGLSKLEDDPVLSALAHTKTIISN
PVIEEALFNSASLN
AGN
GVACGESCIIRPCIFTAILGCRCRFTVCVN
ALETNY
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Viola betonicifolia
Notes
Cyclic No

Assay
No assays found

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Domains vibe 12 (1701)
Nucleic acids vibe 12 precursor
Structure
Links

Tools