vibe 2 precursor [partial](1813) Protein Card

General Information
Name vibe 2 precursor [partial]
Sequence
FEKDFITPEAVRAILKKTNANVMPSEDAINALTGKTVVSN

VVLEEALLKNLDNGLN
GIPCGESCVWIPCLTSAIGCSCSS
KVCYKN
SLHN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Viola betonicifolia
Notes
Cyclic No

Assay
No assays found

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Domains vibe 2 (1694)
Nucleic acids vibe 2 precursor [partial]
Structure
Links

Tools