cycloviolacin O17(177) Protein Card

General Information
Name cycloviolacin O17
Alternative name(s) cyO17
Sequence GIPCGESCVWIPCISAAIGCSCKNKVCYRN
Class Cyclotide
Technique MS,Amino acid analysis
Average Mass 3151.72
Monoisotopic Mass 3149.38
m/z M+H 3151.72
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
Cancer Cell Toxicity
Cytotoxic activity against human cancer cell lines of anpy A, anpy B, anpy C, cyO4 and cyO17 [...]Fernández-Bobey,A. et al. (2022) J Nat Prod :0-0
Hemolytic
The toxicity of the cyclotides (anpy A, anpy B, cyO4, and cyO17) against human red blood cells. [...]Fernández-Bobey,A. et al. (2022) J Nat Prod :0-0

References
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Fernández-Bobey,A., Pinto,M., de Almeida,L.C., de Souza,B.M., Dias,N.B., de Paula-Souza,J., Cilli,E.M., Lopes,N.P., Costa-Lotufo,L.V., Palma,M.S., and da Silva Bolzani,V. (2022) Cytotoxic Cyclotides from Anchietea pyrifolia, a South American Plant Species. J Nat Prod :0-0

Cross-references
Nucleic acids
Structure
Links SwissProt P85180

3D models Download or view with Jmol

Tools