vibe 11(1700) Protein Card

General Information
Name vibe 11
Sequence GAFCFETCVFLPCFSSGIGCYCAWHYCVQD
Class Cyclotide
Technique MS,NGS
Average Mass 3351.83
Monoisotopic Mass 3349.3
m/z M+H 3351.83
ProteinType Wild type
Parent
Organism Viola betonicifolia
Notes acyclotide
Cyclic No

Assay
No assays found

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U., Hettiarachchi,C.M. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Protein precursor(s) vibe 11 precursor
Nucleic acids
Structure
Links

Tools