MTAbl00(1608) Protein Card

General Information
Name MTAbl00
Sequence GGVCPKILKKCRRDSDCPGACICRGNGYCEAIYAAPFA
Class Squash trypsin inhibitor
Average Mass 3983.65
Monoisotopic Mass 3980.82
m/z M+H 3983.65
ProteinType Grafted
Parent MCoTI-II
Organism Synthetic
Notes
Cyclic Yes

Assay
No assays found

References
Huang,Y.H., Henriques,S.T., Wang,C.K., Thorstholm,L., Daly,N.L., Kaas,Q. and Craik,D.J. (2015) Design of substrate-based BCR-ABL kinase inhibitors using the cyclotide scaffold. Sci Rep 5:12974-0

Cross-references
Nucleic acids
Structure
Links

Tools