ctr pep 47 precursor [partial](1507) Protein Card

General Information
Name ctr pep 47 precursor [partial]
Sequence MFAVKATEV
GIPCVESCVFIPCTVTALLGCSCKDKVCYKN

HVIAAEANTV
NDHHLLCQSHEDCFKKGTGNFCAPFLKHDV
KYGWCFRA
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Domains ctr pep 47 (1452)
Nucleic acids
Structure
Links GenBank MT468722 

Tools