ctr pep 37 precursor(1494) Protein Card

General Information
Name ctr pep 37 precursor
Sequence PSYNKYLRSTKSE
MAYIKLASLAVLFFFAASMEKIEA
DTI
PCGESCVFIPCTSSVLGCSCKDKFCYNN
HVIAATSKSM
DE
HHLLCQSHYDCITKGSGNFCAPFLEHDVPYGWCFRAESEG
FLLKD
FLKTPADTLKMPNAI
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Domains ctr pep 37 (1449)
Nucleic acids
Structure
Links GenBank MT468701

Tools