ctr pep 8 precursor(1457) Protein Card

General Information
Name ctr pep 8 precursor
Sequence PITHFR
MAYLRLTSLAVIFFLATSVMFTLKKTEG
GRPTCG
ETCFKTKCYTKGCSCSYPVCKRN
HIIALEAKTV
DEHRLLC
ESHEDCFKKGTGNYCASFPNSDIHFGWCFYAESEGYLLKD

FLKMSKDDLKTPIESPY
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Domains ctr pep 8 (1432)
Nucleic acids
Structure
Links GenBank MT468669

Tools