ctr pep 47(1452) Protein Card

General Information
Name ctr pep 47
Sequence GIPCVESCVFIPCTVTALLGCSCKDKVCYKN
Class Cyclotide
Technique NGS
Average Mass 3270.92
Monoisotopic Mass 3268.49
m/z M+H 3270.92
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Was detected in <i>C. ternatea</i> stem by NGS (Kalmankar et al., 2020).
Cyclic Yes

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) ctr pep 47 precursor [partial]
Nucleic acids
Structure
Links

Tools