Hyla-br1(1318) Protein Card

General Information
Name Hyla-br1
Sequence GVIPCGESCVFIPCISSFLGCSCKNKVCYRN
Class Cyclotide
Technique MS
Average Mass 3303.91
Monoisotopic Mass 3301.47
m/z M+H 3303.91
ProteinType Wild type
Parent
Organism Pombalia lanata
Notes
Cyclic Yes

Assay
No assays found

References
Cunha NB, Barbosa AE, de Almeida RG, Porto WF, Maximiano MR, Álvares LC, Munhoz CB, Eugênio CU, Viana AA, Franco OL, Dias SC (2016) Cloning and characterization of novel cyclotides genes from South American plants Peptide Science 106:784-795

Cross-references
Nucleic acids
Structure
Links

Tools