gassericin A(117) Protein Card

General Information
Name gassericin A
Sequence IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGV
TLPAWALAAAGALGATAA
Class Bacterial
Average Mass 5653.58
Monoisotopic Mass 5650.02
m/z M+H 5651.03
ProteinType Wild type
Parent
Organism Lactobacillus gasseri LA39
Notes
Cyclic Yes

Assay
Anti-bacterial
Both gassericin A and reutericin 6 assessed by viability on indicator cells L. delbrueckii subsp. bulgaricus JCM 1002T. [...]Kawai Y et al. (2004) Appl Environ Microbiol 70:2906-11

References
Kawai Y, Saito T, Toba T, Samant SK, Itoh T (1994) Isolation and characterization of a highly hydrophobic new bacteriocin (gassericin A) from Lactobacillus gasseri LA39. Biosci Biotechnol Biochem 58:1218-21
Kawai Y, Saito T, Kitazawa H, Itoh T (1998) Gassericin A
an uncommon cyclic bacteriocin produced by Lactobacillus gasseri LA39 linked at N- and C-terminal ends. Biosci Biotechnol Biochem 62:2438-40
Kawai Y, Saito T, Suzuki M, Itoh T (1998) Sequence analysis by cloning of the structural gene of gassericin A, a hydrophobic bacteriocin produced by Lactobacillus gasseri LA39. Biosci Biotechnol Biochem 62:887-92
Kawai Y, Ishii Y, Arakawa K, Uemura K, Saitoh B, Nishimura J, Kitazawa H, Yamazaki Y, Tateno Y, Itoh T, Saito T (2004) Structural and functional differences in two cyclic bacteriocins with the same sequences produced by lactobacilli. Appl Environ Microbiol 70:2906-11
Kawai Y, Kemperman R, Kok J, Saito T (2004) The circular bacteriocins gassericin A and circularin A. Curr Protein Pept Sci 5:393-8

Cross-references
Nucleic acids Lactobacillus gasseri DNA for Gassericin A
Structure
Links GenBank BAA22261.1
SwissProt O24790

Tools