Helianthus schweinitzii preproalbumin PawS1 (cPawS1) gene, complete cds(427) Nucleic Acid Card

General Information
Name Helianthus schweinitzii preproalbumin PawS1 (cPawS1) gene, complete cds
Sequence AAAGATTATACATGAGTCTTACAAGTACAACATAAATCAT
CACTACTTAGCTAACCCACGTGTACTCCATGCAAATCAAC
CAGTTACACTATAAATTAAGTAGTAAAGTAATAGTAATAA
TAATAATAACTCAAAAGACAACCTCAATGGCAAAACTTAT
AACACTTGTTGTACTCGCTATCTTAGCATTTGTTGAGGTT
TCTGTTTCTGGTTACAAAACCTCTATCTCCACCATCACCA
TAGAGGACAATGGCAGGTGTACAAAGTCGATTCCCCCGAT
TTGTTTTCCCGATGGCCTGGACAACCCCCGAGGCTGCCAG
ATTCGGATCCAGCAGCTGAACCACTGCCAGATGCACCTCA
CCTCTTTCAATTACAAGCTCAGGATGGCGGTGGAGAACCC
GAAACAACAACAACACCTTAGTCTGTGCTGCAACCAGCTA
CAAGAAGTGGAGAAGCAATGTCAGTGTGAGGCGATCAAAC
AGGTGGTGGAACAAGCTCAAAAGCAGCTGGAGCAAGGTCA
AGGTGGACAGCAGCAGGTGCAACAGATGGTGAAGAAGGCT
CAGATGCTCCCCAACCAATGCAACTTGCAATGCTCGATCT
GATCAGTCACAAGCAAGCACTAGTGTTTGTTTGAGTTTGA
ATGTATGCATGCATGTAATAAATAATAGTAATGCATGATC
GCTCTTTGGCTTGAGATGGGAAGCCGCTTTTCTCTGCATA
ATA
Notes
Sequence translation MAKLITLVVLAILAFVEVSVSGYKTSISTITIEDNGRCTK
SIPPICFPDGLDNPRGCQIRIQQLNHCQMHLTSFNYKLRM
AVENPKQQQHLSLCCNQLQEVEKQCQCEAIKQVVEQAQKQ
LEQGQGGQQQVQQMVKKAQMLPNQCNLQCSI
Organism Helianthus schweinitzii

References
Elliott,A.G., Delay,C., Liu,H., Phua,Z., Rosengren,K.J., Benfield,A.H., Panero,J.L., Colgrave,M.L., Jayasena,A.S., Dunse,K.M., Anderson,M.A., Schilling,E.E., Ortiz-Barrientos,D. and Mylne,J.S. (2014) Evolutionary origins of a bioactive peptide buried within Preproalbumin. Plant Cell 26:981-995

Cross-references
Proteins Encoded Helianthus schweinitzii PawS1 (cPawS1)
Links GenBank JX262721