vian 17 precursor mRNA(420) Nucleic Acid Card

General Information
Name vian 17 precursor mRNA
Sequence GAGGGAGGATATATACTAAATCTTTGGAAAATAAATCCGG
ATAAATTACATTAAAAACTTATGAATTGCAAGATATTGCA
TCTTAGTCCACAAAGTCTCAAAAGTTACAAAAAAATCTCT
ACAGTTTTATAAAGATTGCAATTTGAAACCAAGCATGCTT
GCTACTAGCACCAAACGCGCGAGCATCAAGAAGTAGAGAA
AGAGATAAACCTTAATCAGTTGGCAAGAAGAGAGTTCTTG
TGACAAAAATTGTACTCGCAAGAACACCCAATGATTGCAG
TGTGGCATGGACGCCAGAGACAAGTTTCCGCGCAAGGGAT
TCCATCCAACTTGACATTATTACTCCTCATCATCTTGAGA
GCCTCCTCAAAAACGAGGTTGTCAGCGATGACGATCTTGC
CGGTGAGGGCATTAACGGCATCCTCCGAGTCTGAGAGCAT
GTAATTGGAGTTGGGGTTGGTTTTCTTCTGATCAAGAATA
GCCTGAATAGCTTCAGGTGTGATGACATCTCTCTCAAAGG
TTCCAAGAGATGGAAGTGGAAAGGTTGCAATGAGCACAAG
CCCTACAAACATATTCTTGGCATCCATATATTTCGCAAAT
ATTTAAGAATGTTACTCTTTTTTCTCTAATAAAGCTTGGT
CCATAGTTGTGTGATTGCCGGTGTATTTGCAGCGATGGTG
CGGGTTGTGGGGCT
Notes c106142_g2_i1
Sequence translation MDAKNMFVGLVLIATFPLPSLGTFERDVITPEAIQAILDQ
KKTNPNSNYMLSDSEDAVNALTGKIVIADNLVFEEALKMM
RSNNVKLDGIPCAETCLWRPCHTAIIGCSCEYNFCHKNSL
LAN
Organism Viola anagae

References
Slazak,B., Kaltenböck,K., Steffen,K., Rogala,M., Rodríguez-Rodríguez,P., Nilsson,A., Shariatgorji,R. and Göransson,U. (2021) Cyclotide host-defense tailored for species and environments in violets from the Canary Islands. Sci Rep 11:12452-0

Cross-references
Proteins Encoded vian 17 precursor
Links