vibe 22 precursor(403) Nucleic Acid Card

General Information
Name vibe 22 precursor
Sequence AAAGCAGTGAAAGAAACACTACAAACAAACGAAAGAAAGA
AAGAAAGAAGCATGGATACCCAAAAGATGAAGATGGTGAT
CGGTCTTGTGCTCGTCGCCACCGTGACTTTTGCTCTGATG
ATCCCTGCAGCTTCTGCAGTGGACGATTTCATCACTCGTC
GAGCATACGACAATCTTGTCAAGAGCGGTGCCATCAATGA
CATTCCAGTCATGGCCAAAACCATCATCTCAAACCCAGTC
CTTGACAAGAGCGGTGCCAGCGATGACAATCCAGTCATGG
CCGAAACCATCATCTCAAACCCAGTCCTTGACAAGAGCGG
TGCCAGCGATGACAATCCAGTCATGGCCGAAACCATCATC
TCAAACCCAGTCCTTGAAGAAGCACTGCATACTTATTATT
ACTCAAACAAACTCCGCGGTAGCTTCAGTCGATGTTCGGG
AAGTTGCAGAAACACCCCATGCCCTCCTGGGTGTTTTTGC
ACAACAAGATTCACGTGCATATGAAATTCTCTAGACGACA
GTACCACGGCTGATGAGGAGGCAGTATTCGCTGCTGCGTT
TGCCAGGAAAGCTCTTGAAGGTCTTAATGCTAATTAATAA
AATTAATTAATTAAGCTCGACACATGCATCTACATGTTGT
CTAGATTGATTAATTAATTATGTTGCAAAAAAGTACTGGA
CACTATCGTACTATTTATACCCTCTCACATAAACGGTGGA
TTCTACATAGGATTCATCGTATAAAGAGTGAGTTTCACCG
CTAGTTAAGTACCTTGTAAATTTCCTTTCTTTTTAGAACA
GTATGTTATATGTACTCACTTAAAACTTGAATTAAATAAA
GTCTAGTGCTATATAAT
Notes >Scaffold cDNA sequences- vibe 22- c30816_g1_i3 len=857
Sequence translation MDTQKMKMVIGLVLVATVTFALMIPAASAVDDFITRRAYD
NLVKSGAINDIPVMAKTIISNPVLDKSGASDDNPVMAETI
ISNPVLDKSGASDDNPVMAETIISNPVLEEALHTYYYSNK
LRGSFSRCSGSCRNTPCPPGCFCTTRFTCI*
Organism Viola betonicifolia

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Proteins Encoded vibe 22 precursor
Links