vibe 16 precursor [partial](397) Nucleic Acid Card

General Information
Name vibe 16 precursor [partial]
Sequence AAAAGAAAAGAAAAGAAAAGAATAGAATGAACAAAGCTTG
CTCTTGTATGGTGTGTGTAGCCAATCTTTAGGAAGAAAGG
GATGGCAATACCCAAGCTTGTTCAAGTGAGGCCTTTCTTA
GCGACAGAAACGAATGCTTCTTCAACATGTGGGAAAACTT
GTTTCGGGGGTATATGCAACACCCCTGGGTGCAGCTGCAG
CTCCTGGCCAATGTGTATGAAGAACTCTCTCGCTATATAA
GATCGATCG
Notes > Scaffold cDNA sequences- vibe 16- c40332_g1_i1 len=249
Sequence translation PIFRKKGMAIPKLVQVRPFLATETNASSTCGKTCFGGICN
TPGCSCSSWPMCMKNSLAI*
Organism Viola betonicifolia

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Proteins Encoded vibe 16 precursor [partial]
Links