Viba18 precursor [partial](390) Nucleic Acid Card

General Information
Name Viba18 precursor [partial]
Sequence TTTTGATAAAAATCATGATAATCATATTGATTGGAGAAAT
TTTATATACACAATAAATATAGAAACTGAAAATTACATGT
AACTTCTTAAGAAAATGAGGGAGCATATATACTAAATCTT
TGGAAAATAAATCCGGATAAATTACATTAACAACTATGAA
TTGCAAAATATTCGACAGTTTTATAAAGATTGCAATTTGA
AACCAAGCATGCTTGCTACAAGCACCAAACGCGCGAGCAT
CAAGAAGTAGAGAGAGAGATCAGCTTAATCAGTTGGCAAG
AAGAGAGTTCTTGTAACAAATCTTGTTCTCGCAAGAACAC
CCAATGTATGCAGTGCGGCATGTACCCCACAAACAAGTTT
CCGCGCAGTGGATTCCATCCAACTTGACACTATTACTCCT
CATCATCCTAAGCGCCTCCTCAAGAAAGAGGTTGTCAGCG
ATGACGATCTTGCCGGTGAGGGCATTAACGACATCCTCCG
AGTCTGAGAGCATGTAATTGGAGTTGGGGTTGGTTTTCTT
CTGATCAAGAATAGCCTGAATAGCTTCAGGTGTGATGACA
TCTCTCTCAAAGGTTGCAAGAGATGGA
Notes >Scaffold cDNA sequences- vibe 9- c25751_g1_i2 len=587
Sequence translation PSLATFERDVITPEAIQAILDQKKTNPNSNYMLSDSEDVV
NALTGKIVIADNLFLEEALRMMRSNSVKLDGIHCAETCLW
GTCRTAYIGCSCENKICYKNSLLAN*
Organism Viola betonicifolia

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Proteins Encoded Viba18 precursor [partial]
Links