Cyclolinopeptide precursor(339) Nucleic Acid Card

General Information
Name Cyclolinopeptide precursor
Sequence ATGGCTGTTGTGTCCTCTCTGGCTCTGACCACTAGCCTAG
TTGCTACCGCCGCCGGCCGTAATAATAATGCCTTCCCACC
ATCCTCCTCCAGGAACAACAAGGCACCAGCAGACCTTTTC
ATTACTCCCAAGACAACAACAACAGTGAAAGCAGCAGCTG
TCTCATGCAAACGTCCCTACCCGAAAGGAGCAGTTGCTGC
TGCTACTAGTACCTTGTCTCCTATTTCTGGAAAGGATGGC
GGCCTCCGCAACCAGGAGGAGAGCGATGGTATGTTGGTCT
TCCCCTTATTTATATTCGGCAAGGAAGGTAGTCAGGACAA
GTATAATGGAGCAGCTGCCCTCCGCGACCAGGAGGAGAGC
GATGGTATGTTGATCCCCCCCTTCTTTGTCATATTCGGCA
AGGAAGGTTGTCAGGATATCGGCCACAAGTATAATAATGC
CGCAGCAGCTGGCGCCCTCCGCGACCAGGAGGAGAGCGAT
GGTATACTGGTCCCCCCCTTCTTTCTCATATTCGGCAAGG
AAGGTAGTCAGGACAAGTATAATGCAGCAGCAGCTGGCGG
CCTCCGCGGCAAGGAGCAGCAGGGTGACAAGATGGCGGCT
GGAGCTGAGAATTAG
Notes
Sequence translation MAVVSSLALTTSLVATAAGRNNNAFPPSSSRNNKAPADLF
ITPKTTTTVKAAAVSCKRPYPKGAVAAATSTLSPISGKDG
GLRNQEESDGMLVFPLFIFGKEGSQDKYNGAAALRDQEES
DGMLIPPFFVIFGKEGCQDIGHKYNNAAAAGALRDQEESD
GILVPPFFLIFGKEGSQDKYNAAAAGGLRGKEQQGDKMAA
GAEN
Organism Linum usitatissimum (flax)

References
Burnett, P.G.G., Jadhav, P.D., Okinyo-Owiti, D.P., Poth, A.G. and Reaney, M.J. (2015) Glycine-containing flaxseed orbitides Journal of natural products 78:681-688

Cross-references
Proteins Encoded Cyclolinopeptide precursor
Links GenBank AFSQ0101