cT38 mRNA (partial)(327) Nucleic Acid Card

General Information
Name cT38 mRNA (partial)
Sequence GTGCTATGATAACAAACTTTGCAAAACCAATAACAACAAA
TATCAGTAATTAGTTATTTTCATCAACTCGTCATGGCCAA
CGTTAAGCTTGCTACTCTGCTTGTCAATTTTTTGCTTGTC
ACTTCTGTTATGTTTGTGGTAAAGAAGACGGAAGCCAAAA
TTCCTTGCGGTGAATCTTGTGTATGGATTCCATGCTTCAC
ATCGGCTTTTGGTTGTTATTGTCAAAGCAAAGTTTGTTAT
CATAGCACTCAAATTGCATCAACTGCAAAGACGATGAATG
ACCATCATCTGTTATGTCAATCTCATGAAGACTGCATCAT
AAAAAAAAGTGGAAACTTTTGCGCTCATTTCTCAAACCAA
GATAT
Notes
Sequence translation MANVKLATLLVNFLLVTSVMFVVKKTEAKIPCGESCVWIP
CFTSAFGCYCQSKVCYHSTQIASTAKTMNDHHLLCQSHED
CIIKKSGNFCAHFSNQD
Organism Clitoria ternatea L

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0

Cross-references
Proteins Encoded cT38 precursor [partial]
Links GenBank KT732734