cliotide T17 cds(254) Nucleic Acid Card

General Information
Name cliotide T17 cds
Sequence atggcttatgttaggcttactcccctcgctgtcatcttct
tccttgccacttctgttatgtttgcagtaaagacagaagc
tggtactgtcccttgtggagaatcttgtgtatttatccca
tgtataactgggattgctggttgttcttgtaagaacaaag
tttgttatctaaaccatgttattgccgctgaagcaaagac
catggatgaacaccatcttttgtgccaatcccatgaagat
tgcattaaaaagggaactggaaacttttgcgctccttttc
ttgaacataatgttaactatggctggtgttttaatgctca
atcagaaggatatttgttgaaagatttcttaaagatacct
aagacaatcactaac
Notes
Sequence translation MAYVRLTPLAVIFFLATSVMFAVKTEAGTVPCGESCVFIP
CITGIAGCSCKNKVCYLNHVIAAEAKTMDEHHLLCQSHED
CIKKGTGNFCAPFLEHNVNYGWCFNAQSEGYLLKDFLKIP
KTITN
Organism Clitoria ternatea L

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0

Cross-references
Proteins Encoded cliotide T17
Links GenBank KT732714