Protein List

Found 27 entries.


ID Name Sequence
1228 Modi 2 GGACPKILQKCRRDSDCPGACVCQGNGYCGSGSD
1161 MCoTI-29 GGACPKILQRCRRDSDCPGACICRGNGYCGSGSD
1226 MCoTI-13 GGACPKILQRCRRDSDCPSACICRGNGYCGSGSD
797 MCoTI-VII GGACPRILKKCRRDSDCPGACVCKGNGYCGSGSD
796 MCoTI-IV GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
1231 Modi 4 GGACPRILKKCRRDSDCPGACVCRGNGYCGSGSD
1164 MCoTI-31 GGACPRILKKCRRDSDCPSACICQGNGYCGSGSD
1230 MCoTI-16 GGACPRILKQCRRDSDCPGACICQGNGYCGSGSD
1229 MCoTI-15 GGACPRILKQCRRDSDCPGACVCQGNGYCGSGSD
1163 MCoTI-30 GGACPRILQKCRRNSDCPSACVCQGNGYCGSGSD
1233 MCoTI-18 GGICPKILQRCRRDSDCPGACICRGNGYCGSGSD
3 MCoTI-II GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD
798 MCoTI-VIII GGVCPKILQRCRRDSDCPGACICLGNGYCGSGSD
1237 MCoTI-21 GGVCPKILQRCRRDSDCPGACICQGNGYCGSGSD
137 MCoTI-I GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
1238 MCoTI-22 GGVCPRILKKCRRDSDCPGACICRGNGYCGSGSD
1234 MCoTI-19 QQRACPRILKKCRRDSDCPGECICKGNGYCG
1240 MCoTI-24 QRACPKILKRCRRDSDCPGACVCQDNGYCGSGGD
794 MCoTI-III QRACPRILKKCRRDSDCPGECICKENGYCG
793 MCoTI-V QRACPRILKKCRRDSDCPGECICKGNGYCG
795 MCoTI-VI QRACPRILKKCRRDSDCPGECICQGNGYCG
1245 MCoTI-27 QRACPRILKRCRRDSDCPGACVCQDNGYCGSGGD
1244 MCoTI-26 QRACPRILKRCRRDSDCPGACVCQGNGYCGSRGD
1241 MCoTI-25 QRACPRILKRCSRDSDCPGACVCQDNGYCGSRGD
1249 MCoTI-28 RICPRIWMECKRDSDCMAQCICVDGHCG
1213 MCo-CVX-6D VCPK(DOTA)ILQRCRRDSDCPGACICRGNGYCGSYRJCR
GpRRBCYJR
1167 MCoTI-32 ZRVCPRILKKCRRDSDCPGECICQGNGYCG