Protein List

Found 14 entries.


ID Name Sequence
1162 Modi 2 GGACPKILQKCRRDSDCPGACVCQGNGYCGSGSD
1161 Modi 1 GGACPKILQRCRRDSDCPGACICRGNGYCGSGSD
797 MCoTI-VII GGACPRILKKCRRDSDCPGACVCKGNGYCGSGSD
796 MCoTI-IV GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
1166 Modi 4 GGACPRILKKCRRDSDCPGACVCRGNGYCGSGSD
1164 Modi 5 GGACPRILKKCRRDSDCPSACICQGNGYCGSGSD
1163 Modi 3 GGACPRILQKCRRNSDCPSACVCQGNGYCGSGSD
3 MCoTI-II GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD
798 MCoTI-VIII GGVCPKILQRCRRDSDCPGACICLGNGYCGSGSD
137 MCoTI-I GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
794 MCoTI-III QRACPRILKKCRRDSDCPGECICKENGYCG
793 MCoTI-V QRACPRILKKCRRDSDCPGECICKGNGYCG
795 MCoTI-VI QRACPRILKKCRRDSDCPGECICQGNGYCG
1167 Modi 6 ZRVCPRILKKCRRDSDCPGECICQGNGYCG