Protein List

Found 15 entries.


ID Name Sequence
1213 MCo-CVX-6D VCPK(DOTA)ILQRCRRDSDCPGACICRGNGYCGSYRJCR
GpRRBCYJR
137 MCoTI-I GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
3 MCoTI-II GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD
794 MCoTI-III QRACPRILKKCRRDSDCPGECICKENGYCG
796 MCoTI-IV GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
793 MCoTI-V QRACPRILKKCRRDSDCPGECICKGNGYCG
795 MCoTI-VI QRACPRILKKCRRDSDCPGECICQGNGYCG
797 MCoTI-VII GGACPRILKKCRRDSDCPGACVCKGNGYCGSGSD
798 MCoTI-VIII GGVCPKILQRCRRDSDCPGACICLGNGYCGSGSD
1161 Modi 1 GGACPKILQRCRRDSDCPGACICRGNGYCGSGSD
1162 Modi 2 GGACPKILQKCRRDSDCPGACVCQGNGYCGSGSD
1163 Modi 3 GGACPRILQKCRRNSDCPSACVCQGNGYCGSGSD
1166 Modi 4 GGACPRILKKCRRDSDCPGACVCRGNGYCGSGSD
1164 Modi 5 GGACPRILKKCRRDSDCPSACICQGNGYCGSGSD
1167 Modi 6 ZRVCPRILKKCRRDSDCPGECICQGNGYCG