Protein List

Found 8 entries.


ID Name Sequence
137 MCoTI-I GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
3 MCoTI-II GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD
794 MCoTI-III QRACPRILKKCRRDSDCPGECICKENGYCG
796 MCoTI-IV GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
793 MCoTI-V QRACPRILKKCRRDSDCPGECICKGNGYCG
795 MCoTI-VI QRACPRILKKCRRDSDCPGECICQGNGYCG
797 MCoTI-VII GGACPRILKKCRRDSDCPGACVCKGNGYCGSGSD
798 MCoTI-VIII GGVCPKILQRCRRDSDCPGACICLGNGYCGSGSD