Protein List

Found 9 entries.


ID Name Sequence
578 BTD-a RCVCTRGF
580 BTD-b RCVCRRGVC
582 BTD-c RCICLLGIC
584 BTD-d RCFCRRGVC
85 RTD-1 RCICTRGFCRCLCRRGVC
91 RTD-1a MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDD
QGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL
92 RTD-1b MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGADD
QGMAHSFTRPENAALPLSESARGLRCLCRRGVCQLL
89 RTD-2 GVCRCLCRRGVCRCLCRR
90 RTD-3 GFCRCICTRGFCRCICTR