Protein List

Found 619 entries.


ID Name Sequence
1554 hyen AT AIPCGESCVFIPCFTKVIGCSCRSRVCYL
1584 hyen BY AIPCGESCVWIPCFSSVIGCRCRSKVCYR
51 circulin F AIPCGESCVWIPCISAAIGCSCKNKVCYR
865 chassatide C8 AIPCGESCVWIPCISTVIGCSCSNKVCYR
1574 hyen BO ALFCGESCFVGSCNKSPAGCRCSYPFCIKN
1563 hyen BB ALICGESCFTGKCYSEVIGCGCSWPLCKKN
1433 ctr pep 11  ANIPMTCGPCLTDECWTPGCEYHCKYCKNS
539 Globa C APCGESCVYIPCLLTAPIGCSCSNIVCYRN
1089 cT22 ARIPCGESCVWIPCTITALVGCACHEKVCYKS
1530 hyen W AVPCGESCVIIPCFTGIVGCGCTNKVCYIN
1578 hyen BS AVPCGESCVWIPCISSIAGCSCSNSVCYLN
1523 hyen R AVPCGESCVWIPCITSIAGCSCSNKVCYMN
1083 cT45 CGESCVFLPCFIIPGCSCKDKVCYLN
1439 ctr pep 20  CVIPCGESRVFIPCITGAIGCSCKSKVCYRN
185 cycloviolacin O25 DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
1103 cT42 DIPCGSTCLHVKCIPPCYCKNKVLCYRN
1562 hyen BA DLICSQTCFSHPCVPQCVCRNFICYRN
999 Cter 18 DLICSSTCLHTPCKASVCYCKNAVCYKN
974 cliotide T21 DLQCAETCVHSPCIGPCYCKHGLICYRN
1007 Cter 31 DLQCAETCVHSPCIGPCYCKHGVICYKN
1449 ctr pep 37  DTIPCGESCVFIPCTSSVLGCSCKDKFCYNN
967 cliotide T14 DTIPCGESCVWIPCISSILGCSCKDKVCYHN
966 cliotide T13 DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
1556 hyen AU ELISCGESCVYFPCITRIVGCRCRRNVCWLQ
876 chassatide C12 EYCGESCYLIPCFTPGCYCVSRQCVNKN
1580 hyen BU FFPCTESCGVLPCLTSLIGCRCVDKICVKD
346 CD-1 GADGFCGESCVYIPCISYLVGCSCDTIEKVCKRN
988 Cter 3 GAFCGETCVLGTCYTPDCSCKAVVCIKN
1010 Cter 35 GAFCGETCVLGTCYTPGCSCAPVICLNN
1217 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD
954 vitri peptide 27a GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
439 Viba 8 GAGCIETCYTFPCISEMINCSCKNSRCQKN
810 caripe 6 GAICTGTCFRNPCLSRRCTCRHYICYLN
1521 hyen P GAIPCGESCVYIPCISTVLGCSCSNKVCYKN
1005 Cter 29 GALCDERCTYVPCISAARGCSCNIHRVCSMN
1541 hyen AG GAMPCGESCVYIPCTVTALLGCSCKNNVCYKN
31 vodo M GAPICGESCFTGKCYTVQCSCSWPVCTRN
960 vitri peptide 39 linear GAPICGESCFTGTCYTVQCSCSWPVCTRN
959 vitri peptide 39 GAPICGESCFTGTCYTVQCSCSWPVCTRN
508 cycloviolacin O32 GAPVCGETCFGGTCNTPGCTCDPWPVCTND
949 vitri peptide 22a GAPVCGETCFTGLCYSSGCSCIYPVCNRN
867 chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN
1278 Viba42 GASCVETCNYFPCISEMINCYCQSKRCVKN
1321 HB5 GAVPCGESCVYLPCLTTVVGCSCQNSVCYHN
1322 HB6 GAVPCGETCVYLPCITAAIGCSCQNKVCYRD
1218 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD
1431 ctr pep 6  GCLPICGETCFKTKCYTKGCSCSYPICKKN
869 chassatide C1 GDACGETCFTGICFTAGCSCNPWPTCTRN
1429 cter pep 4 GDALKCGETCFGGTCYTPGCSCDYPICKKN
962 vitri peptide 50 GDIPCGESCVYIPCITGVLGCSCSHNVCYYN
544 Glopa C GDIPLCGETCFEGGNCRIPGCTCVWPFCSKN
1009 Cter 33 GDLFKCGETCFGGTCYTPGCSCDYPICKKN
980 cliotide T32 GDLFKCGETCFGGTCYTPGCSCDYPICKNN
1196 psyleio B GDLPICGETCFGGTCNTPGCVCAWPVCNR
1198 psyleio C GDLPVCGETCFGGTCNTPGCVCAWPVCTR
947 vitri peptide 20 GDLVPCGESCVYIPCLTTVLGCSCSENVCYRN
991 Cter 7 GDPFKCGESCFAGKCYTPGCTCEYPICMNN
1444 ctr pep 29  GDPFKCGESCFAGKCYTPGCTCSRPICKKN
989 Cter 4 GDPLACGETCFGGTCYTPGCVCDPWPICTKN
1098 cT31 GDPLKCGESCFAGKCYTPGCTCDRPICKKN
987 Cter 2 GDPLKCGESCFAGKCYTPGCTCEYPICMNN
1096 cT30 GDPLKCGESCFAGKCYTPGCTCSRPICKKN
5 palicourein GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
958 vitri peptide 38 GDTCYETCFTGFCFIGGCKCDFPVCVKN
765 cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN
990 Cter 5 GEFLKCGESCVQGECYTPGCSCDYPICKNN
145 Hyfl E GEIPCGESCVYLPCFLPNCYCRNHVCYLN
953 vitri peptide 24/28 GEPVCGDSCVFFGCDDEGCTCGPWSLCYRN
1290 ViulJ GEVTCNGETCFTGKCNAKGCNCKNWPLCTRN
874 chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN
956 vitri peptide 30 GFACGETCIFTSCFITGCTCNSSLCFRN
1575 hyen BP GFHCRESCRHTRCSIAACSCSKDKYCMRN
1093 cT26 GFICGESCVYIPCITALLGCSCSNQICSKN
345 PS-1 GFIPCGETCIWDKTCHAAGCSCSVANICVRN
1585 hyen BZ GFLQSCGEGCFFKPCTKPGCTCLADLCVTN
1200 psybry A GFNPCGETCIWFPTCHAPGCTCSIANICVRN
1202 psybry C GFNPCGETCQIDQTCHAPGCTCSIANICVRN
1201 psybry B GFNPCGETCWNKPTCHAPGCTCSIANICVRN
981 cliotide T33 GFNSCSEACVYLPCFSKGCSCFKRQCYKN
862 chassatide C13 GFPCAESCVYIPCTVTALLGCSCRNRVCYRN
70 cycloviolin D GFPCGESCVFIPCISAAIGCSCKNKVCYRN
1081 cT23 GFPCGESCVFIPCTVTALLGCSCKDKVCYKN
1139 hyen D GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
1539 hyen AE GFPCGESCVYIPCTVTALWGCACWEHVCYTN
1262 Viba26 GFPCGESCVYVPCLTAAIGCSCKNKVCYKN
563 kalata B19 GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
1006 Cter 30 GFPICGETCFKTKCYTPGCSCSYPVCKKN
1172 Mang A GFPTCGETCTLGTCNTPGCTCSWPICTRD
1186 Mobo A GFPTCGETCTLGTCNTPGCTCSWPICTRN
1576 hyen BQ GFSCGQSCVFLPCLNPGPIPPSCRCVKGECVRN
1285 ViulE GGHCGESCMLLPCFTARIGCSCSRSICYKN
948 vitri peptide 21 GGPLDCQETCTLSDRCYTKGCTCNWPICYKN
979 cliotide T28 GGSIPCGESCVFLPCFLPGCSCKSSVCYLN
542 Glopa A GGSIPCIETCVWTGCFLVPGCSCKSDKKCYLN
744 Parigidin-br1 GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
1316 Parigidin-br2 GGSVPCGESCVFIPCLTSLAGCSCKNKVCYYN
543 Glopa B GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
1450 ctr pep 38  GGTACGESCIYLPCISGVFEGCSCQNKACYKN
348 cycloviolacin Y2 GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTN
167 tricyclon B GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN
7 tricyclon A GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN
349 cycloviolacin Y3 GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTN
347 cycloviolacin Y1 GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN
961 vitri peptide 24a GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
957 vitri peptide 36/37 GGTIFSCGESCFQGTCYTKGCACGDWKLCYGEN
1214 MCoTI-ID GGVCPK(DOTA)ILQRCRRDSDCPGACICRGNGYCGSGSD
413 Mra26 GHPICGETCVGNKCYTPGCTCTWPVCYRN
409 Mra24 GHPTCGETCLLGTCYTPGCTCKRPVCYKN
150 Hyfl J GIACGESCAYFGCWIPGCSCRNKVCYFN
552 psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN
877 Phyb A GIGCGESCVWIPCVSAAIGCSCSNKICYRN
1280 Viba44 GIHCAETCFWGTCRTAYIGCSCENRICYKN
1264 Viba28 GIHCAETCIWGTCRTAIIGCSCENRICYKN
1254 Viba18 GIHCAETCLWGTCRTAYIGCSCENKICYKN
1194 Vpub C GIIPCGESCVFIPCITSIVGCSCKSKVCYKN
1193 Vpub B GIIPCGESCVFIPCITSVVGCSCKSKVCYKN
1542 hyen AH GIIPCGESCVWIPCTVTAVMGCSCKDNVCYRN
1538 hyen AD GIIPCGETCIWDKKCHIQGCSCKHDICVRN
1536 hyen AB GIIPCGETCIWDKTCHIPGCKCEHNICVRN
1582 hyen BW GIPCAESCVFIPCTITALLGCKCQSKVCYN
1581 hyen BV GIPCAESCVFIPCTITALLGCKCQSNVCYN
1154 Poca B GIPCAESCVFIPCVTAILGCSCKDRVCYN
868 chassatide C2 GIPCAESCVWIPCTITALMGCSCKNNVCYNN
755 viphi H GIPCAESCVWIPCTVTAIVGCSCSWGVCYN
356 vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN
1583 hyen BX GIPCAESCVWIPCTVTALLGCKCQSNVCYN
587 Cter E GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
586 Cter D GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
378 Viba 12 GIPCAESCVWIPCTVTALLGCSCKDKVCYN
1540 hyen AF GIPCAESCVWIPCTVTALLGCSCSDKVCYN
6 vhr1 GIPCAESCVWIPCTVTALLGCSCSNKVCYN
169 cycloviolacin H4 GIPCAESCVWIPCTVTALLGCSCSNNVCYN
351 cycloviolacin Y5 GIPCAESCVWIPCTVTALVGCSCSDKVCYN
541 Glopa E GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
1178 Mden G GIPCAESCVYIPCITAALGCSCKNKVCYRN
1570 hyen BK GIPCAESCVYIPCIVSVILGCSCQSKVCYN
1131 Mra2 GIPCAESCVYIPCLTSAGCSCKSKVCYRN
389 Mra5 GIPCAESCVYIPCLTSAIGCSCKSKVCYRN
1130 Mra1 GIPCAESCVYIPCLTSIGCSCKSKVCYRN
864 chassatide C14 GIPCAESCVYIPCTITALFGCSCKDKVCYNN
255 kalata B17 GIPCAESCVYIPCTITALLGCKCKDQVCYN
254 kalata B16 GIPCAESCVYIPCTITALLGCKCQDKVCYD
861 chassatide C15 GIPCAESCVYIPCTITALLGCSCKDKVCYKN
43 Hypa A GIPCAESCVYIPCTITALLGCSCKNKVCYN
1320 Visu 2 GIPCAESCVYIPCTITALLGCSCKSKVCYN
1148 hyen L GIPCAESCVYIPCTVTALLGCSCSDKVCYN
2 cycloviolacin O1 GIPCAESCVYIPCTVTALLGCSCSNRVCYN
1273 Viba37 GIPCAESCVYLPCVTIVIGCSCKDEVCYNS
377 Viba 10 GIPCAESCVYLPCVTIVIGCSCKDKVCYN
1292 ViulL GIPCAETCLWRPCRTAIMGCSCEYNFCYKN
114 htf-1 GIPCGDSCHYIPCVTSTIGCSCTNGSCMRN
425 Viba 1 GIPCGEGCVYLPCFTAPLGCSCSSKVCYRN
1324 HB8 GIPCGESCAFLPCLTSLLGCTCQNKVCYRD
881 Phyb G GIPCGESCAWIPCISAVQGCSCRNKICYRN
1587 hyen CB GIPCGESCAWLPFCFTAPLGCTCQDKVCYRN
1543 hyen AI GIPCGESCFWIPCTVTSLLGCSCKSSVCYKY
1599 hyen BE GIPCGESCGESCVFIPCLTSAIGCSCKSKVCYRN
1560 hyen AY GIPCGESCGESCVWIPCISSVLGCSCSNKVCYRN
501 hcf-1 variant GIPCGESCHIPCVTSAIGCSCRNRSCMRN
113 hcf-1 GIPCGESCHYIPCVTSAIGCSCRNRSCMRN
1146 hyen K GIPCGESCIFIPCITTVVGCSCSNKVCYDN
883 Phyb I GIPCGESCIWIPCTTTALLGCSCSNKVCYKN
878 Phyb D GIPCGESCMWIPCISAAIGCSCTNHVCYKN
1532 hyen Y GIPCGESCVFIPCFTSAIGCSCKSKVCYRN
1136 caripe 13 GIPCGESCVFIPCFTSVFGCSCKDKVCYRN
859 chassatide C18 GIPCGESCVFIPCISALLGCSCSNKVCYNN
149 Hyfl I GIPCGESCVFIPCISGVIGCSCKSKVCYRN
1258 Viba22 GIPCGESCVFIPCISSVIGCSCKSKVCYRN
751 viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN
588 Cter F GIPCGESCVFIPCISSVVGCSCKSKVCYLD
759 cliotide T8 GIPCGESCVFIPCISSVVGCSCKSKVCYNN
1189 Vdif A GIPCGESCVFIPCISSVVGCSCKSKVCYRN
599 Cter Q GIPCGESCVFIPCISTVIGCSCKNKVCYRN
598 Cter P GIPCGESCVFIPCITAAIGCSCKSKVCYRN
534 Globa A GIPCGESCVFIPCITAAIGCSCKTKVCYRN
766 cliotide T12 GIPCGESCVFIPCITGAIGCSCKSKVCYRD
975 cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN
597 Cter O GIPCGESCVFIPCITGIAGCSCKSKVCYRN
1590 hyen CE GIPCGESCVFIPCITSIAGCSCQSKVCYLN
48 circulin C GIPCGESCVFIPCITSVAGCSCKSKVCYRN
503 Vpf-1 GIPCGESCVFIPCLTAAIGCSCRSKVCYRN
1550 hyen AP GIPCGESCVFIPCLTAAIGCSCSNRVCYRN
400 Mra30 GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
69 cycloviolin C GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
762 cliotide T9 GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
978 cliotide T11 GIPCGESCVFIPCTITALLGCSCKDKVCYKN
982 cliotide T40 GIPCGESCVFIPCTITALLGCSCKSKVCYKN
600 Cter R GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
827 caripe 7 GIPCGESCVFIPCTVTALLGCSCKNKVCYRN
998 Cter 15 GIPCGESCVFIPCTVTALLGCSCKSKVCYKN
555 psyle D GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
873 chassatide C9 GIPCGESCVFIPCVTTVIGCSCKDKVCYNN
806 caripe 2 GIPCGESCVFIRCTITALLGCSCSNNVCYKN
1447 ctr pep 33  GIPCGESCVFISCTVTALLGCSCKDKVCYKN
1451 ctr pep 43  GIPCGESCVFLPCFIIPGCSCKDKVCYLN
433 Viba 6 GIPCGESCVLIPCISSVIGCSCKSKVCYRN
1529 hyen V GIPCGESCVWIPCFSAAIGCSCRSKVCYRN
1528 hyen U GIPCGESCVWIPCFSAAIGCSCRSRVCYRN
1259 Viba23 GIPCGESCVWIPCFSAAIGCSCSSKVCYRN
177 cycloviolacin O17 GIPCGESCVWIPCISAAIGCSCKNKVCYRN
170 cycloviolacin O13 GIPCGESCVWIPCISAAIGCSCKSKVCYRN
1526 hyen T GIPCGESCVWIPCISAAIGCSCSNKVCYRN
8 circulin A GIPCGESCVWIPCISAALGCSCKNKVCYRN
514 cycloviolacin O29 GIPCGESCVWIPCISGAIGCSCKSKVCYKN
443 Viba 11 GIPCGESCVWIPCISGAIGCSCKSKVCYRN
879 Phyb E GIPCGESCVWIPCISGVQGCSCSNKICYRN
1157 vila A GIPCGESCVWIPCISSAIGCSCKDKVCYRD
787 vigno 6 GIPCGESCVWIPCISSAIGCSCKGSKVCYRN
515 cycloviolacin O30 GIPCGESCVWIPCISSAIGCSCKNKVCFKN
440 Viba 9 GIPCGESCVWIPCISSAIGCSCKNKVCYRK
52 cycloviolacin O4 GIPCGESCVWIPCISSAIGCSCKNKVCYRN
21 cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN
1158 vila B GIPCGESCVWIPCISSAIGCSCRSKVCYRD
870 chassatide C3 GIPCGESCVWIPCISSALGCSCKNKVCYRN
790 vigno 9 GIPCGESCVWIPCISSALGCSCKSKVCYRN
1281 ViulA GIPCGESCVWIPCISSLIGCSCRGKVCYH
1520 hyen O GIPCGESCVWIPCISSVLGCSCSNKVCYRN
1276 Viba40 GIPCGESCVWIPCITAAIGCSCSSKVCYRN
1519 hyen N GIPCGESCVWIPCITAAVGCSCSNKVCYRN
36 vitri A GIPCGESCVWIPCITSAIGCSCKSKVCYRN
789 vigno 8 GIPCGESCVWIPCITSAVGCSCKSKVCYRN
1572 hyen BM GIPCGESCVWIPCLSSAFGCSCRSKVCYRN
428 Viba 3 GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
376 Viba 5 GIPCGESCVWIPCLTATIGCSCKSKVCYRN
1284 ViulD GIPCGESCVWIPCLTSAIGCSCKSKVCYKN
180 cycloviolacin O20 GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
53 cycloviolacin O3 GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
362 vibi K GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
34 cycloviolacin O9 GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
360 vibi I GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
1522 hyen Q GIPCGESCVWLPCFIVPGCSCNDKVCYLN
1594 hyen CJ GIPCGESCVWLPCFTKYIGCGCQSKVCYY
911 Phyb C GIPCGESCVWMYCITATMGCSCRNKVCYKN
1524 hyen S GIPCGESCVYIPCFTAAIGCSCSNKVCYRN
1176 Mden E GIPCGESCVYIPCITAAIGCSCKSKVCYRN
1180 Mden I GIPCGESCVYIPCITTAIGCSCKNKVCYRN
33 cycloviolacin H1 GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
57 cycloviolacin O10 GIPCGESCVYIPCLTSAVGCSCKSKVCYRN
178 cycloviolacin O18 GIPCGESCVYIPCTVTALAGCKCKSKVCYN
977 cliotide T10 GIPCGESCVYIPCTVTALLGCSCKDKVCYKN
1446 ctr pep 31  GIPCGESCVYIPCTVTALLGCSCKNKVCFRN
983 cliotide T54 GIPCGESCVYIPCTVTALLGCSCKNKVCYRN
993 Cter 9 GIPCGESCVYIPCTVTALLGCSCRDKVCYKN
375 Viba 2 GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
390 Mra13 GIPCGESCVYLPCFTTIIGCKCQGKVCYH
553 psyle B GIPCGETCVAFGCWIPGCSCKDKLCYYD
536 Globa D GIPCGETCVFMPCISGPMGCSCKHMVCYRN
880 Phyb F GIPCGGSCVWIPCISGVQGCSCSNKICYRN
1577 hyen BR GIPCPGSCFFIDCNPGPFPPSCKCKGGMCVRN
1452 ctr pep 47  GIPCVESCVFIPCTVTALLGCSCKDKVCYKN
1179 Mden H GIPICGETCFFGKCNTPKCTCNKPLCYKN
1019 mech 7 GIPICGETCTIGTCNTPGCTCSWPVCTRD
1025 mela 6 GIPTCGETCFKGKCYTPGCSCSYPICKKD
1173 Mden A GIPTCGETCTLGTCNTPGCTCSWPICTKN
1160 vila D GIPVCGETCAFGTCYTGGCSCSWPVCTRN
1190 Vinc A GIPVCGETCTLGTCYTAGCSCSWPVCTRN
550 cycloviolacin T1 GIPVCGETCVGGTCNTPGCSCSWPVCTRN
1314 HB10 GISCAETCVKLPCLSSVIGCTCQNKRCYKD
1323 HB7 GISCAETCVLLPCLSSVIGCTCQNKRCYKN
1435 ctr pep 18  GISCGESCVFIPCITGIAGCSCKNKVCYLN
1315 HB11 GISCGETCVLLPCLSSVIGCTCQNKRCYKN
1260 Viba24 GKIPCGESCVWIPCITTVVGCSCSNKVCYKN
1187 Mobo B GKPICGETCAKGKCYTPKCTCNWPICYKN
1022 mela 3 GKPICGETCFKGKCYTPGCTCSYPICKKD
1023 mela 4 GKPICGETCFKGKCYTPGCTCSYPICKKN
1175 Mden C GKPICGETCFKGKCYTPGCTCSYPVCKKN
1311 Rivi4 GKPICGETCLLGKCYTPGCTCGKRVLCYKN
1021 mela 2 GKPTCGETCFKGKCYTPGCTCSYPLCKKD
1020 mela 1 GKYTCGETCFKGKCYTPGCTCSYPICKKD
1525 hyen B GLAKSCGETCKVTKRCSGQGCSCLKGRSCYD
1257 Viba21 GLFCGEYCVQFPCRSPGCICLRGLCVRN
1546 hyen AL GLIPCGESCVLIPCISTIIGCSCKNKVCYRN
1569 hyen BJ GLIPCGESCVWIPCFSAAIGCSCNGQDHVCYRN
938 vitri peptide 1 GLIPCGESCVWIPCISSVIGCSCKSKVCYKN
359 vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
1153 Poca A GLPCAESCVFIPCTITAILGCSCRDRVCYD
1298 Mema A GLPCAESCVWLPCTVTALLGCSCKDKVCYRN
1304 Rili A GLPCAESCVWLPCTVTALLGCTCVDRVCFLD
882 Phyb H GLPCGESCIWIECISGAIGCSCRNKVCYRN
590 Cter H GLPCGESCVFIPCITTVVGCSCKNKVCYND
589 Cter G GLPCGESCVFIPCITTVVGCSCKNKVCYNN
1306 Vide A GLPCGESCVFLPCLTSALGCSCKSKVCYRN
1138 hyen G GLPCGESCVYIPCISTVLGCSCSNKVCYRD
1515 hyen F GLPCGESCVYIPCISTVLGCSCSNKVCYRN
1301 Orto A GLPCGESCVYLPCLLTAPLGCSCKNKVCYRN
176 cycloviolacin O16 GLPCGETCFTGKCYTPGCSCSYPICKKIN
1151 Psysol 2 GLPICGESCVGGTCNTPGCTCTWPVCTRN
1177 Mden F GLPICGETCFFGKCNTPKCTCINPICYKN
573 Oak6 cyclotide 2 GLPICGETCFGGTCNTPGCICDPWPVCTRD
986 Cter 1 GLPICGETCFGGTCNTPNCVCDPWPICTNN
968 cliotide T15 GLPICGETCFKTKCYTKGCSCSYPVCKRN
1174 Mden B GLPICGETCFTGKCYTPGCTCSYPICKKN
1195 psyleio A GLPICGETCFTGTCNTPGCSCTYPICTRD
814 paltet 1 GLPICGETCFTGTCNTPGCTCSYPVCTRN
971 cliotide T18 GLPICGETCFTGTCYTPGCTCSYPVCKKN
1310 Rivi3 GLPICGETCLLGKCYTPGCSCRRPVCYKN
813 psybra 1 GLPICGETCTLGTCNTPGCTCSWPICTKN
1312 Rivi5 GLPICGETCTLGTCNTPGCTCSWPVCFRN
452 Viba 16 GLPICGETCTLGTCYTVGCTCSWPVCTRN
1308 Rivi1 GLPICGETCVFGKCNTPGCSCRRPICYKN
63 varv peptide D GLPICGETCVGGSCNTPGCSCSWPVCTRN
602 vitri C GLPICGETCVGGTCNTPGCFCTWPVCTRN
38 cycloviolacin O12 GLPICGETCVGGTCNTPGCSCSWPVCTRN
182 cycloviolacin O22 GLPICGETCVGGTCNTPGCTCSWPVCTRN
782 vigno 1 GLPLCGETCAGGTCNTPGCSCSWPVCVRN
785 vigno 4 GLPLCGETCVGGTCNTPACSCSWPVCTRN
786 vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN
784 vigno 3 GLPLCGETCVGGTCNTPGCSCSWPVCTRN
246 kalata B10 GLPTCGETCFGGTCNTPGCSCSSWPICTRD
247 kalata B10 linear GLPTCGETCFGGTCNTPGCSCSSWPICTRD
24 kalata B6 GLPTCGETCFGGTCNTPGCSCSSWPICTRN
546 cycloviolacin O36 GLPTCGETCFGGTCNTPGCTCDPFPVCTHD
25 kalata B3 GLPTCGETCFGGTCNTPGCTCDPWPICTRD
184 cycloviolacin O24 GLPTCGETCFGGTCNTPGCTCDPWPVCTHN
183 cycloviolacin O23 GLPTCGETCFGGTCNTPGCTCDSSWPICTHN
1026 mela 7 GLPTCGETCFKGKCYTPGCSCSYPICKKN
1014 mech 2 GLPTCGETCTLGKCNTPKCTCNWPICYKD
1015 mech 3 GLPTCGETCTLGKCNTPKCTCNWPICYKN
1300 Hobo A GLPTCGETCTLGTCNTPGCTCSWPLCTKN
952 vitri peptide 23 GLPTCGETCTLGTCYTPGCTCSWPLCTKN
595 Cter M GLPTCGETCTLGTCYVPDCSCSWPICMKN
965 viba 32 GLPVCGEACVGGTCNTPGCSCSWPVCTRN
1268 Viba32 GLPVCGEACVGGTCNTPGCSCSWPVCTRN
253 kalata B15 GLPVCGESCFGGSCYTPGCSCTWPICTRD
252 kalata B14 GLPVCGESCFGGTCNTPGCACDPWPVCTRD
1199 psyleio D GLPVCGESCFGGTCNTPGCSCTWPVCTRD
354 vibi C GLPVCGETCAFGSCYTPGCSCSWPVCTRN
560 vaby C GLPVCGETCAGGRCNTPGCSCSWPVCTRN
558 vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN
559 vaby B GLPVCGETCAGGTCNTPGCSCTWPICTRN
1305 Rili B GLPVCGETCAGGTCNTPGCSCTWPLCTRN
355 vibi D GLPVCGETCFGGRCNTPGCTCSYPICTRN
251 kalata B13 GLPVCGETCFGGTCNTPGCACDPWPVCTRD
576 Oak6 cyclotide 1 GLPVCGETCFGGTCNTPGCACDPWPVCTRN
139 cycloviolacin H3 GLPVCGETCFGGTCNTPGCICDPWPVCTRN
1269 Viba33 GLPVCGETCFGGTCNTPGCPCEWPVCTRN
61 varv peptide B GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
562 vaby E GLPVCGETCFGGTCNTPGCSCDPWPVCTRN
66 varv peptide H GLPVCGETCFGGTCNTPGCSCETWPVCSRN
1255 Viba19 GLPVCGETCFGGTCNTPGCSCEWPVCTRN
352 vibi A GLPVCGETCFGGTCNTPGCSCSYPICTRN
249 kalata B11 GLPVCGETCFGGTCNTPGCSCTDPICTRD
4 kalata B2 GLPVCGETCFGGTCNTPGCSCTWPICTRD
561 vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
353 vibi B GLPVCGETCFGGTCNTPGCTCSYPICTRN
603 vitri D GLPVCGETCFTGSCYTPGCSCNWPVCNRN
138 vhl-2 GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
749 viphi B GLPVCGETCTIGTCYTAGCTCSWPICTRN
40 vodo N GLPVCGETCTLGKCYTAGCSCSWPVCYRN
26 kalata B7 GLPVCGETCTLGTCYTQGCTCSWPICKRN
1267 Viba31 GLPVCGETCVGGACNTPGCACSWPVCTRN
512 cycloviolacin O34 GLPVCGETCVGGTCNTEYCTCSWPVCTRD
386 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN
384 Viba 17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN
505 cycloviolacin O31 GLPVCGETCVGGTCNTPGCSCSIPVCTRN
72 violapeptide 1 GLPVCGETCVGGTCNTPGCSCSRPVCTXN
507 cycloviolacin O28 GLPVCGETCVGGTCNTPGCSCSWPVCFRD
604 vitri E GLPVCGETCVGGTCNTPGCSCSWPVCFRN
922 vocC GLPVCGETCVGGTCNTPGCSCSWPVCIRN
37 kalata S GLPVCGETCVGGTCNTPGCSCSWPVCTRN
811 chacur 1 GLPVCGETCVGGTCNTPGCTCSWPICTRN
30 kalata B4 GLPVCGETCVGGTCNTPGCTCSWPVCTRD
1 kalata B1 GLPVCGETCVGGTCNTPGCTCSWPVCTRN
1319 Visu 1 GLPVCGETCVGGTCNTPGCTCTWPVCTRN
985 riden A GLPVCGETCVGGTCNTPGCTCTWPVCTRN
513 cycloviolacin O35 GLPVCGETCVGGTCNTPYCFCSWPVCTRD
509 cycloviolacin O33 GLPVCGETCVGGTCNTPYCTCSWPVCTRD
1265 Viba29 GLPVCGETCVGGTCSTPGCGCSWPVCTRN
181 cycloviolacin O21 GLPVCGETCVTGSCYTPGCTCSWPVCTRN
1573 hyen BN GLQRCRESCNRVKCWLPGCECLNKMCYKN
175 cycloviolacin O15 GLVPCGETCFTGKCYTPGCSCSYPICKKN
153 Hyfl M GNIPCGESCIFFPCFNPGCSCKDNLCYYN
1325 HB9 GNPCGESCVYLPCITTVVGCSCQNSVCYHN
1208 cyI6 GNPGACGETCIWGKCYSAKIGCSCSKYKICTLN
1205 cyI3 GNPGACGETCIWGKCYSASIGCSCSKYKVCTLN
1207 cyI5 GNPGACGETCIWGKCYSASIGCSCSRYKVCTLN
1206 cyI4 GNPGACGETCVWGKCYSASIGCSCNKYKVCTLN
1003 Cter 25 GNPIVCGETCFFQKCYTPGCSCDAVICTNN
1591 hyen CF GPPCYSTCRFIPACVKTTWPQCVCKDGVCVVQ
1266 Viba30 GPPVCGETCVGGTCNTPGCSCSWPVCTRN
964 viba 30 linear GPPVCGETCVGGTCNTPGCSCSWPVCTRN
1289 ViulI GPTPCGETCIWISCVTAVMGCSCKNSICYMN
1271 Viba35 GQDFCGGQICFASDCIVVGCECDAWSRCVPS
1287 ViulG GRAVCGETCFAGICYTPVCVCGKWDLCRMN
1286 ViulF GRFCGEICSRGFCSNPRCTCNASRQCVRN
379 Viba 14 GRLCGERCVIERTRAWCRTVGCICSLHTLECVRN
1296 Glopa G GRLPCGESCVFLPCLSAVLGCSCKNKVCYRN
1295 Glopa F GRLPCGESCVFLPCLSVSLGCSCKNKVCYRN
1561 hyen AZ GRPCGEYCLFGRSCVTAVIGCSCSNNVCYQN
1432 ctr pep 8  GRPTCGETCFKTKCYTKGCSCSYPVCKRN
1428 ctr pep 3 GRPTCGETCFKTKCYTPGCSCSYPICKKN
1261 Viba25 GRVPCGESCVYIPCFTSIAGCSCSDKVCWHN
992 Cter 8 GSAFCGETCVLGTCYTPDCSCKAVVCIKN
596 Cter N GSAFCGETCVLGTCYTPDCSCTALVCLKN
538 Globa E GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
1024 mela 5 GSAIACGESCFKFKCYTPGCSCSYPICKKD
411 Mra25 GSAILCGESCTLGECYTPGCTCSWPICTKN
997 Cter 13 GSAIRCGERCLLGRCHRPGCTCIRRICRRN
1442 ctr pep 24  GSAIRCGERCLLGRCHRPGCTCVRRICRRN
973 cliotide T20 GSAIRCGESCLLGKCYTPGCTCDRPICKKN
533 Globa F GSFPCGESCVFIPCISAIAGCSCKNKVCYKN
574 Oak7 cyclotide GSHCGETCFFFGCYKPGCSCDELRQCYKN
174 cycloviolacin O14 GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
1191 Vinc B GSIPACGESCFKGKCYTPGCTCSKYPLCAKN
517 cycloviolacin O27 GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
516 cycloviolacin O26 GSIPACGESCFRGKCYTPGCSCSKYPLCAKD
35 vico A GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
41 vico B GSIPCAESCVYIPCITGIAGCSCKNKVCYYN
417 Mra30a GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
754 viphi G GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
753 viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
752 viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
1188 Pali A GSIPCGESCVFIPCISGLAGCSCKNRVCYLN
399 Mra29 GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
748 viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN
392 Mra14a GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
939 vitri peptide 2 GSIPCGESCVWIPCISGIAGCSCSNKVCYLN
1182 Mden K GSIPCGESCVWIPCISSVVGCACKNKVCYKN
1181 Mden J GSIPCGESCVYIPCISSIVGCACKSKVCYKN
397 Mra17a GSIPCGESCVYIPCISSLLGCSCESKVCYKN
1016 mech 4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKD
388 Mra4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKN
1132 Mra3 GSIPCGESCVYIPCITSIVGCSCKSKVCYKN
1183 Mden L GSIPCGESCVYIPISAVLGCSCKNKVCYRN
1274 Viba38 GSIPSCGESCFKGKCYTPGCSCSKYPLCAKK
1270 Viba34 GSIPSCGESCFKGKCYTPGCSCSKYPLCAKN
1275 Viba39 GSIPSCGESCFKGKCYTPGCSCSKYPLCAYE
1277 Viba41 GSIPSCGESCFKGKCYTPVCSCSKYPLCAKN
995 Cter 11 GSIRCGERCLLGRCHRPGCTCIRRICRRN
1091 cT25 GSIRCGERCLLGRCHRPGCTCVRRICRRN
1440 ctr pep 22  GSITGCGGGCLLGRCYRPGCTCVRRICRRN
250 kalata B12 GSLCGDTCFVLGCNDSSCSCNYPICVKD
1279 Viba43 GSLPCGESCVFIPCISSVIGCACKSKVCYKN
1445 ctr pep 30  GSPCGESCVFIPCISTVIGCSCKNKVCYRN
1534 hyen AA GSPCGEYCVFHPSCITAIIGCSCRNRVCYKN
142 Hyfl B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
143 Hyfl C GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
1012 Cter 37 GSPTCGETCFGGTCYTPGCVCDPWPICTKN
1011 Cter 36 GSPTCGETCFGGTCYTPNCVCDPWPICTKN
502 Vpl-1 GSQSCGESCVLIPCISGVIGCSCSSMICYFN
944 vitri peptide 14 GSSCGETCEVFSCFITRCACIDGLCYRN
1443 ctr pep 26  GSSIVTCGETCLRGKCYTPGCTCVRPICKKN
783 vigno 2 GSSPLCGETCAGGTCNTPGCSCSWPVCVRD
1144 hyen I GSTPCGESCVWIPCISGIVGCSCSNKVCYMD
963 vitri peptide 18b GSVFNCGETCVFGTCFTSGCSCVYRVCSKD
245 kalata B9 linear GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
244 kalata B9 GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
817 psypoe 1 GSVICGETCFTTVCNTPGCYCGAYXCTRN
969 cliotide T16 GSVIGCGETCLRGRCYTPGCTCDHGICKKN
972 cliotide T19 GSVIKCGESCLLGKCYTPGCTCSRPICKKN
168 kalata B8 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
1149 hyen J GSVPCGESCVWIPCITSIAGCSCSNKVCYMD
1307 Vini A GSVPCGESCVWLPCLSGLAGCSCKNKVCYYD
144 Hyfl D GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
940 vitri peptide 3 GSWPCGESCVYIPCITSIAGCECSKNVCYKN
1309 Rivi2 GSYLCGETCVQGKCYTPGCTCSWPICKKN
1272 Viba36 GSYYSCGETCRKTKCYTPDCICAWPGLCGKN
68 cycloviolin B GTACGESCYVLPCFTVGCTCTSSQCFKN
1283 ViulC GTFCGETCVMFPCFSSARGCGCHNLGCELN
358 vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
361 vibi J GTFPCGESCVWIPCISKVIGCACKSKVCYKN
1204 cyI2 GTFPCGESCVWIPCISSVVGCSCKSKVCYKN
1203 cyI1 GTFPCGESCVYIPCISSVVGCSCKSKVCYKN
1170 hyen C GTHPCQETCVTSTRCSTQGCHCNWPICFKN
943 vitri peptide 9a/53 GTIFDCGETCLLGKCYTPGCSCGSWALCYGQN
393 Mra14b GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
357 vibi F GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
791 vigno 10 GTIPCGESCVWIPCISSVVGCSCKSKVCYKD
1184 Mden M GTIPCGESCVYIPCITSALGCSCKKKVCYKN
1185 Mden N GTIPCGESCVYIPCLTSALGCSCKNKVCYRN
55 cycloviolacin O6 GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
28 cycloviolacin O11 GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
605 vitri F GTLPCGESCVWIPCISSVVGCACKSKVCYKD
1159 vila C GTLPCGESCVWIPCISSVVGCSCKDKVCYKD
788 vigno 7 GTLPCGESCVWIPCISSVVGCSCKNKVCYKN
179 cycloviolacin O19 GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
27 cycloviolacin O8 GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
152 Hyfl L GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
1595 hyen CK GTPCGESCAFRPCISGRIGCQCKHRFCYR
941 vitri peptide 4 GTPCGESCIYVPCISAVFGCWCQSKVCYKD
54 cycloviolacin O5 GTPCGESCVWIPCISSAVGCSCKNKVCYKN
1537 hyen AC GTPCGESCVWIPCVTTIVGCSCKSNVCYLN
151 Hyfl K GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
59 kalata B5 GTPCGESCVYIPCISGVIGCSCTDKVCYLN
1533 hyen Z GTPCGESCVYIPCLSTVLGCSCSNRICYRN
1567 hyen BH GTPCGESCVYIPCLTTIVGCSCKSNVCYLN
613 HB1 GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
1220 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD
592 Cter J GTVPCGESCVFIPCITGIAGCSCKNKVCYID
591 Cter I GTVPCGESCVFIPCITGIAGCSCKNKVCYIN
970 cliotide T17 GTVPCGESCVFIPCITGIAGCSCKNKVCYLN
1299 Mema B GTVPCGESCVWLPCLTGLVGCSCKNNVCYTN
1171 Ltri A GVACGESCVYLPCFTVGCTCTSSQCFKN
951 vitri peptide 94b GVAVCGETCTLGTCYTPGCSCDWPICKRN
1251 Vodo I1 GVFCGEACAQASCSIAGCECIAGLCYKN
1252 Vodo I2 GVFCGELCIKASCSIPGCECIAGLCYKN
1253 Vodo I3 GVFCGEPCIKASCSIPGCECIAGLCYKN
1135 caripe 12 GVIPCGESCVFIPCFSSVIGCSCKNKVCYRN
1133 caripe 10 GVIPCGESCVFIPCFSTVIGCSCKNKVCYRN
1013 mech 1 GVIPCGESCVFIPCINKKKCSCKNKVCYRD
67 cycloviolin A GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
1192 Vpub A GVIPCGESCVFIPCISAVIGCSCKSKVCYRN
535 Globa B GVIPCGESCVFIPCISAVLGCSCKSKVCYRN
1318 Hyla-br1 GVIPCGESCVFIPCISSFLGCSCKNKVCYRN
872 chassatide C6 GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
436 Viba 7 GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
556 psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
407 Mra23 GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
871 chassatide C5 GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
1017 mech 5 GVIPCGESCVFIPCISSVVGCTCKNKVCYRD
1018 mech 6 GVIPCGESCVFIPCISSVVGCTCKNKVCYRN
1152 NorA GVIPCGESCVFIPCISTLIGCSCKNKVCYRN
984 cliotide T55 GVIPCGESCVFIPCISTLIGCSCKNKVCYRN
45 circulin B GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
805 caripe 1 GVIPCGESCVFIPCISTVIGCSCKDKVCYRN
1134 caripe 11 GVIPCGESCVFIPCISTVIGCSCKKKVCYRN
477 Cter A GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
828 caripe 8 GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
557 psyle F GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
1082 cT27 GVIPCGESCVFIPCITGAIGCSCKSKVCYRN
1004 Cter 28 GVIPCGESCVWIPCISAAIGCSCKKNVCYRN
1544 hyen AJ GVIPCGESCVYIPCTVTALLGCSCSNKVCYKN
1001 Cter 20 GVIPCGESCVYLPCLTTIVGCSCKNNVCYTN
1297 Hyde B GVLPCGESCVFDRTCHLAGCGCGSTVPLCVRN
585 Cter C GVPCAESCVWIPCTVTALLGCSCKDKVCYLD
478 Cter B GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
344 kalata B18 GVPCAESCVYIPCISTVLGCSCSNQVCYRN
860 chassatide C16 GVPCAESCVYIPCTITALFGCSCKDKVCYNN
350 cycloviolacin Y4 GVPCGESCVFIPCITGVIGCSCSSNVCYLN
575 Oak8 cyclotide GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
1282 ViulB GVPCGESCVWIPCLTGAIGCSCSNKVCYLN
430 Viba 4 GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
405 Mra22 GVPCGESCVWIPCLTSIVGCSCKNNVCTLNS
1303 Rigra A GVPCGESCVWLPCTVTALLGCKCETRGCTLN
909 Phyb B GVPCGESCVWMYCISAAMGCSCRNKVCYRN
540 Glopa D GVPCGESCVWVPCTVTALMGCSCVREVCRKD
1137 hyen E GVPCGESCVYIPCFTGIINCSCRDKVCYNN
750 viphi C GVPCGESCVYIPCITSVIGCSCSSKVCYIN
1453 ctr pep 48  GVPCGESCVYIPCTVTALLGCSCKNKVCYRN
946 vitri peptide 18a GVPICGETCFQGTCNTPGCTCKWPICERN
64 varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN
62 varv peptide C GVPICGETCVGGTCNTPGCSCSWPVCTRN
955 vitri peptide 29 GVPSSDCLETCFGGKCNAHRCTCSQWPLCAKN
65 varv peptide G GVPVCGETCFGGTCNTPGCSCDPWPVCSRN
1263 Viba27 GVQCGPTCRFGPVNCGINPRCNCRNTRCVWD
601 vitri B GYPICGESCVGGTCNTPGCSCSWPVCTTN
594 Cter L HEPCGESCVFIPCITTVVGCSCKNKVCYD
593 Cter K HEPCGESCVFIPCITTVVGCSCKNKVCYN
1471 ctr pep 22 precursor IKNN
MASFRFAPLALIFIFALCVMFAVDNTEA
GSITGCGG
GCLLGRCYRPGCTCVRRICRRN
HIIAAEANTV
DDHHLLCE
SHDDCFKKGSGYYCAFFPDTNIHYGWCIYAESEGYKLKD
F
LETSINLEISMAITN
1596 hyen CL IPCGERCEFMPCYTRVIACSCRNKVCYRGSS
875 chassatide C11 IPCGESCVWIPCISGMFGCSCKDKVCYS
866 chassatide C7 IPCGESCVWIPCITAIAGCSCKNKVCYT
863 chassatide C17 IPCGESCVYIPCISAVLGCSCQNKVCYR
1598 hyen CN IPCLESCVHLPCIFTGPTLGCSCKNNVCYR
1559 hyen AX IPCLESCVYLPCIFTGPTLGCSCKNNVCYR
746 HB2 IQCGESCVWIPCISSAWGCSCKNKICSS
1516 cT38 KIPCGESCVWIPCFTSAFGCYCQSKVCYHS
1008 Cter 32 KIPCGESCVWIPCISSILGCSCKDKVCYHN
50 circulin E KIPCGESCVWIPCLTSVFNCKCENKVCYHD
49 circulin D KIPCGESCVWIPCVTSIFNCKCENKVCYHD
1150 hyen H KIPCGESCVYIPCISSVLGCSCSNKVCYKD
554 psyle C KLCGETCFKFKCYTPGCSCSYPFCK
1551 hyen AQ KVPCGESCAWVNFCFTSVVGCSCQDKVCYMN
808 caripe 4 LICSSTCLRIPCLSPRCTCRHHICYLN
1483 ctr pep 31 precursor [partial] LYQLNQN
MAFARLAVIFFLAASVMFTVKETEA
GIPCGESC
VYIPCTVTALLGCSCKNKVCFRN
HVIA
1448 ctr pep 35  NIFPCGESCVYIPCITSIVGCSCQNKVCYNN
996 Cter 12 NTAFCGETCVLGTCYTPDCSCKAVVCIKN
1002 Cter 22 NTAFCGETCVLGTCYTPDCSCTAIVCIKN
1557 hyen AV PAAFPCGESCVYIPCLTTAIGCSCKNKVCYHD
1558 hyen AW PAAFPCGESCVYIPCVTTLIGCSCKDKVCYHD
1256 Viba20 PISCGETCKFSRCFTSIFGCKCINKVCHT
1564 hyen BC PLICGETCFTGTCYSAQIGCSCSWPVCMKN
1313 Parigidin-br3 PSPCGESCVFIPCISALIGCSCKNKVCYR
942 vitri peptide 8 PTPCGETCIWISCVTAAIGCYCHESICYR
778 Panitide L3 QAFCGETCLLGKCYTPGCSCHTGICLK
774 Panitide L4 QAFCGETCLLGTCYTPGCRCTAGICLK
780 Panitide L7 QAFCGETCVLGTCYTPGCSCNFGICLK
1326 HB3 QCGESCVWIPCISSAWGCSCKNKICSS
1327 HB4 QCGESCVWIPCISSAWGCSCKNKICSS
781 Panitide L8 QDCGETCVLGTCYTPGCSCSAYPLCV
772 Panitide L2 QLPICGETCVLGRCYTPNCRCQYPICVR
771 Panitide L1 QLPICGETCVLGTCYTPGCRCQYPICVR
779 Panitide L5 QLPICGETCVLGTCYTPGCSCAYPICAR
776 Panitide L6 QLPICGETCVLGTCYTPGCSCAYPICVR
886 Phyb L QSISCAETCVWIPCATSLIGCSCVNSICTYTN
1553 hyen AS QVSCGETCKSGPCSYPRCTCTAKICVLY
1547 hyen AM RFTSCQEGCFFRPCTTPGCRCLADLCVKN
140 cycloviolacin H2 SAIACGESCVYIPCFIPGCSCRNRVCYLN
172 violacin A SAISCGETCFKFKCYTPRCSCSYPVCK
1288 ViulH SELPCGESCVFIPCITSIAGCSCSHKVCYLN
1291 ViulK SIFCSETCRTFPCFTKAVGCSCVSKRCYKN
1589 hyen CD SIGCGESCVYLGCFIIPACRTCRNNACYLN
1141 hyen M SIPCAESCVWIPCTVTALLGCSCSDKVCYN
1586 hyen CA SIPCGESCALFDFCFTAPLGCTCQNKVCYKN
1588 hyen CC SIPCGESCAWFDFCFTAPLGCTCQNKVCSIN
1531 hyen X SIPCGESCVFIPCFTGVVGCGCTNKVCYIN
1552 hyen AR SIPCGESCVFIPCFTRVIGCSCRNKVCYRG
32 cyclopsychotride A SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
1566 hyen BG SIPCGESCVIIPCITGIFGPCSCKSKVCYFN
56 cycloviolacin O7 SIPCGESCVWIPCTITALAGCKCKSKVCYN
976 cliotide T6 SIPCGESCVYIPCLTTIVGCSCKNSVCYSN
1000 Cter 19 SIPCGESCVYIPCLTTIVGCSCKSNVCYSN
1593 hyen CH SIPCGESCVYLPCFSAIFGCRCNENRICVKG
1592 hyen CG SIPCGESCVYLPCFSAIFGCRCNEYSLCVKG
1545 hyen AK SIPCGETCVWLPCFIVPGCSCKDKVCYIN
86 vhl-1 SISCGESCAMISFCFTEVIGCSCKNKVCYLN
141 Hyfl A SISCGESCVYIPCTVTALVGCTCKDKVCYLN
146 Hyfl F SISCGETCTTFNCWIPNCKCNHHDKVCYWN
1597 hyen CM SMPCGETCYFIPCLTKLINCECVNNICVLGA
885 Phyb K STDCGEPCVYIPCTITALLGCSCLNKVCVRP
1568 hyen BI SVPCGESCVFIPCVTGIIGCECKSKVCYLN
1197 psyleio E SVTPIVCGETCFGGTCNTPGCSCSWPICTK
994 Cter 10 SYIPCGESCVYIPCTVTALLGCSCSNKVCYKN
884 Phyb J SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
447 Viba 13 TIPCAESCVWIPCTVTALLGCSCKDKVCYN
1571 hyen BL TPCGETCKYIPCITLIYPPCECKDGLCVWPSVD
1065 Cter acyc 1 VDGFCLETCVILPCFSSVAGCYCHGSTCMRG
1579 hyen BT VLSCIETCVYIPCITSLIGCSCKDKICYLN
1565 hyen BF YYCGETCKFITCTFSRLEWCSCQNKRCMNN