Protein List

Found 310 entries.


ID Name Sequence
51 circulin F AIPCGESCVWIPCISAAIGCSCKNKVCYR
539 Globa C APCGESCVFIPCISAVLGCSCKSKVCYRN
185 cycloviolacin O25 DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
876 chassatide C12 EYCGESCYLIPCFTPGCYCVSRQCVNKN
346 CD-1 GADGFCGESCYVIPCISYLVGCSCDTIEKVCKRN
954 vitri peptide 27a GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
439 Viba 8 GAGCIETCYTFPCISEMINCSCKNSRCQKN
810 caripe 6 GAICTGTCFRNPCLSRRCTCRHYICYLN
865 chassatide C8 GAIPCGESCVWIPCISTVIGCSCSNKVCYR
31 vodo M GAPICGESCFTGKCYTVQCSCSWPVCTRN
960 vitri peptide 39 linear GAPICGESCFTGTCYTVQCSCSWPVCTRN
959 vitri peptide 39 GAPICGESCFTGTCYTVQCSCSWPVCTRN
508 cO32 GAPVCGETCFGGTCNTPGCTCDPWPVCTND
949 vitri peptide 22a GAPVCGETCFTGLCYSSGCSCIYPVCNRN
867 chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN
869 chassatide C1 GDACGETCFTGICFTAGCSCNPWPTCTRN
962 vitri peptide 50 GDIPCGESCVYIPCITGVLGCSCSHNVCYYN
544 Glopa C GDIPLCGETCFEGGNCRIPGCTCVWPFCSKN
947 vitri peptide 20 GDLVPCGESCVYIPCLTTVLGCSCSENVCYRN
5 palicourein GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
958 vitri peptide 38 GDTCYETCFTGFCFIGGCKCDFPVCVKN
765 cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN
145 Hyfl E GEIPCGESCVYLPCFLPNCYCRNHVCYLN
953 vitri peptide 24/28 GEPVCGDSCVFFGCDDEGCTCGPWSLCYRN
874 chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN
956 vitri peptide 30 GFACGETCIFTSCFITGCTCNSSLCFRN
345 PS-1 GFIPCGETCIWDKTCHAAGCSCSVANICVRN
862 chassatide C13 GFPCAESCVYIPCTVTALLGCSCRNRVCYRN
70 cycloviolin D GFPCGESCVFIPCISAAIGCSCKNKVCYRN
563 kalata B19 GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
948 vitri peptide 21 GGPLDCQETCTLSDRCYTKGCTCNWPICYKN
542 Glopa A GGSIPCIETCVWTGCFLVPGCSCKSDKKCYLN
744 Parigidin-br1 GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
543 Glopa B GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
348 cycloviolacin Y2 GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTN
167 tricyclon B GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN
7 tricyclon A GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN
349 cycloviolacin Y3 GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTN
347 cycloviolacin Y1 GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN
961 vitri peptide 24a GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
957 vitri peptide 36/37 GGTIFSCGESCFQGTCYTKGCACGDWKLCYGEN
413 Mra26 GHPICGETCVGNKCYTPGCTCTWPVCYRN
409 Mra24 GHPTCGETCLLGTCYTPGCTCKRPVCYKN
150 Hyfl J GIACGESCAYFGCWIPGCSCRNKVCYFN
552 psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN
877 Phyb A GIGCGESCVWIPCVSAAIGCSCSNKICYRN
868 chassatide C2 GIPCAESCVWIPCTITALMGCSCKNNVCYNN
755 viphi H GIPCAESCVWIPCTVTAIVGCSCSWGVCYN
356 vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN
587 Cter E GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
586 Cter D GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
378 Viba 12 GIPCAESCVWIPCTVTALLGCSCKDKVCYN
6 vhr1 GIPCAESCVWIPCTVTALLGCSCSNKVCYN
169 cycloviolacin H4 GIPCAESCVWIPCTVTALLGCSCSNNVCYN
351 cycloviolacin Y5 GIPCAESCVWIPCTVTALVGCSCSDKVCYN
541 Glopa E GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
389 Mra5 GIPCAESCVYIPCLTSAIGCSCKSKVCYRN
864 chassatide C14 GIPCAESCVYIPCTITALFGCSCKDKVCYNN
255 kalata B17 GIPCAESCVYIPCTITALLGCKCKDQVCYN
254 kalata B16 GIPCAESCVYIPCTITALLGCKCQDKVCYD
861 chassatide C15 GIPCAESCVYIPCTITALLGCSCKDKVCYKN
43 Hypa A GIPCAESCVYIPCTITALLGCSCKNKVCYN
2 cycloviolacin O1 GIPCAESCVYIPCTVTALLGCSCSNRVCYN
377 Viba 10 GIPCAESCVYLPCVTIVIGCSCKDKVCYN
114 htf-1 GIPCGDSCHYIPCVTSTIGCSCTNGSCMRN
425 Viba 1 GIPCGEGCVYLPCFTAPLGCSCSSKVCYRN
881 Phyb G GIPCGESCAWIPCISAVQGCSCRNKICYRN
501 hcf-1 variant GIPCGESCHIPCVTSAIGCSCRNRSCMRN
113 hcf-1 GIPCGESCHYIPCVTSAIGCSCRNRSCMRN
883 Phyb I GIPCGESCIWIPCTTTALLGCSCSNKVCYKN
878 Phyb D GIPCGESCMWIPCISAAIGCSCTNHVCYKN
859 chassatide C18 GIPCGESCVFIPCISALLGCSCSNKVCYNN
149 Hyfl I GIPCGESCVFIPCISGVIGCSCKSKVCYRN
751 viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN
588 Cter F GIPCGESCVFIPCISSVVGCSCKSKVCYLD
759 cliotide T8 GIPCGESCVFIPCISSVVGCSCKSKVCYNN
599 Cter Q GIPCGESCVFIPCISTVIGCSCKNKVCYRN
598 Cter P GIPCGESCVFIPCITAAIGCSCKSKVCYRN
534 Globa A GIPCGESCVFIPCITAAIGCSCKTKVCYRN
766 cliotide T12 GIPCGESCVFIPCITGAIGCSCKSKVCYRD
597 Cter O GIPCGESCVFIPCITGIAGCSCKSKVCYRN
48 circulin C GIPCGESCVFIPCITSVAGCSCKSKVCYRN
503 Vpf-1 GIPCGESCVFIPCLTAAIGCSCRSKVCYRN
400 Mra30 GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
69 cycloviolin C GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
762 cliotide T9 GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
600 Cter R GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
827 caripe 7 GIPCGESCVFIPCTVTALLGCSCKNKVCYRNGLN
555 psyle D GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
873 chassatide C9 GIPCGESCVFIPCVTTVIGCSCKDKVCYNN
806 caripe 2 GIPCGESCVFIRCTITALLGCSCSNNVCYKN
433 Viba 6 GIPCGESCVLIPCISSVIGCSCKSKVCYRN
177 cycloviolacin O17 GIPCGESCVWIPCISAAIGCSCKNKVCYRN
170 cycloviolacin O13 GIPCGESCVWIPCISAAIGCSCKSKVCYRN
8 circulin A GIPCGESCVWIPCISAALGCSCKNKVCYRN
514 cO29 GIPCGESCVWIPCISGAIGCSCKSKVCYKN
443 Viba 11 GIPCGESCVWIPCISGAIGCSCKSKVCYRN
879 Phyb E GIPCGESCVWIPCISGVQGCSCSNKICYRN
787 vigno 6 GIPCGESCVWIPCISSAIGCSCKGSKVCYRN
515 cO30 GIPCGESCVWIPCISSAIGCSCKNKVCFKN
440 Viba 9 GIPCGESCVWIPCISSAIGCSCKNKVCYRK
52 cycloviolacin O4 GIPCGESCVWIPCISSAIGCSCKNKVCYRN
21 cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN
790 vigno 9 GIPCGESCVWIPCISSALGCSCKSKVCYRN
36 vitri A GIPCGESCVWIPCITSAIGCSCKSKVCYRN
789 vigno 8 GIPCGESCVWIPCITSAVGCSCKSKVCYRN
428 Viba 3 GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
866 chassatide C7 GIPCGESCVWIPCLTAIAGCSCKNKVCYT
376 Viba 5 GIPCGESCVWIPCLTATIGCSCKSKVCYRN
180 cycloviolacin O20 GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
53 cycloviolacin O3 GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
362 vibi K GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
34 cycloviolacin O9 GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
360 vibi I GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
911 Phyb C GIPCGESCVWMYCITATMGCSCRNKVCYKN
863 chassatide C17 GIPCGESCVYIPCISAVLGCSCQNKVCYR
33 cycloviolacin H1 GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
57 cycloviolacin O10 GIPCGESCVYIPCLTSAVGCSCKSKVCYRN
178 cycloviolacin O18 GIPCGESCVYIPCTVTALAGCKCKSKVCYN
375 Viba 2 GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
390 Mra13 GIPCGESCVYLPCFTTIIGCKCQGKVCYH
870 chassatide C3 GIPCGESCWIPCISSALGCSCKNKVCYRN
553 psyle B GIPCGETCVAFGCWIPGCSCKDKLCYYD
536 Globa D GIPCGETCVFMPCISGPMGCSCKHMVCYRN
880 Phyb F GIPCGGSCVWIPCISGVQGCSCSNKICYRN
1026 mela 7 GIPTCGETCFKGKCYTPGCSCSYPICKKN
1014 mech 2 GIPTCGETCTLGKCNTPKCTCNWPICYKD
1015 mech 3 GIPTCGETCTLGKCNTPKCTCNWPICYKN
550 cycloviolacin T1 GIPVCGETCVGGTCNTPGCSCSWPVCTRN
746 hedyotide B2 GIQCGESCVWIPCISSAWGCSCKNKICSS
938 vitri peptide 1 GLIPCGESCVWIPCISSVIGCSCKSKVCYKN
359 vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
882 Phyb H GLPCGESCIWIECISGAIGCSCRNKVCYRN
590 Cter H GLPCGESCVFIPCITTVVGCSCKNKVCYND
589 Cter G GLPCGESCVFIPCITTVVGCSCKNKVCYNN
176 cycloviolacin O16 GLPCGETCFTGKCYTPGCSCSYPICKKIN
573 Oak6 cyclotide 2 GLPICGETCFGGTCNTPGCICDPWPVCTRD
814 paltet 1 GLPICGETCFTGTCNTPGCTCSYPVCTRN
813 psybra 1 GLPICGETCTLGTCNTPGCTCSWPICTKN
452 Viba 16 GLPICGETCTLGTCYTVGCTCSWPICTRN
63 varv peptide D GLPICGETCVGGSCNTPGCSCSWPVCTRN
602 vitri C GLPICGETCVGGTCNTPGCFCTWPVCTRN
38 cycloviolacin O12 GLPICGETCVGGTCNTPGCSCSWPVCTRN
182 cycloviolacin O22 GLPICGETCVGGTCNTPGCTCSWPVCTRN
782 vigno 1 GLPLCGETCAGGTCNTPGCSCSWPVCVRN
785 vigno 4 GLPLCGETCVGGTCNTPACSCSWPVCTRN
786 vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN
784 vigno 3 GLPLCGETCVGGTCNTPGCSCSWPVCTRN
246 kalata B10 GLPTCGETCFGGTCNTPGCSCSSWPICTRD
247 kalata B10 linear GLPTCGETCFGGTCNTPGCSCSSWPICTRD
24 kalata B6 GLPTCGETCFGGTCNTPGCSCSSWPICTRN
546 Co36 GLPTCGETCFGGTCNTPGCTCDPFPVCTHD
25 kalata B3 GLPTCGETCFGGTCNTPGCTCDPWPICTRD
184 cycloviolacin O24 GLPTCGETCFGGTCNTPGCTCDPWPVCTHN
183 cycloviolacin O23 GLPTCGETCFGGTCNTPGCTCDSSWPICTHN
952 vitri peptide 23 GLPTCGETCTLGTCYTPGCTCSWPLCTKN
595 Cter M GLPTCGETCTLGTCYVPDCSCSWPICMKN
253 kalata B15 GLPVCGESCFGGSCYTPGCSCTWPICTRD
252 kalata B14 GLPVCGESCFGGTCNTPGCACDPWPVCTRD
354 vibi C GLPVCGETCAFGSCYTPGCSCSWPVCTRN
560 vaby C GLPVCGETCAGGRCNTPGCSCSWPVCTRN
558 vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN
559 vaby B GLPVCGETCAGGTCNTPGCSCTWPICTRN
355 vibi D GLPVCGETCFGGRCNTPGCTCSYPICTRN
251 kalata B13 GLPVCGETCFGGTCNTPGCACDPWPVCTRD
576 Oak6 cyclotide 1 GLPVCGETCFGGTCNTPGCACDPWPVCTRN
139 cycloviolacin H3 GLPVCGETCFGGTCNTPGCICDPWPVCTRN
61 varv peptide B GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
562 vaby E GLPVCGETCFGGTCNTPGCSCDPWPVCTRN
66 varv peptide H GLPVCGETCFGGTCNTPGCSCETWPVCSRN
352 vibi A GLPVCGETCFGGTCNTPGCSCSYPICTRN
249 kalata B11 GLPVCGETCFGGTCNTPGCSCTDPICTRD
4 kalata B2 GLPVCGETCFGGTCNTPGCSCTWPICTRD
561 vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
353 vibi B GLPVCGETCFGGTCNTPGCTCSYPICTRN
603 vitri D GLPVCGETCFTGSCYTPGCSCNWPVCNRN
138 vhl-2 GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
749 viphi B GLPVCGETCTIGTCYTAGCTCSWPICTRN
40 vodo N GLPVCGETCTLGKCYTAGCSCSWPVCYRN
26 kalata B7 GLPVCGETCTLGTCYTQGCTCSWPICKRN
512 cO34 GLPVCGETCVGGTCNTEYCTCSWPVCTRD
386 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN
384 Viba 17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN
505 cO31 GLPVCGETCVGGTCNTPGCSCSIPVCTRN
72 violapeptide 1 GLPVCGETCVGGTCNTPGCSCSRPVCTXN
507 cO28 GLPVCGETCVGGTCNTPGCSCSWPVCFRD
604 vitri E GLPVCGETCVGGTCNTPGCSCSWPVCFRN
922 vocC GLPVCGETCVGGTCNTPGCSCSWPVCIRN
37 kalata S GLPVCGETCVGGTCNTPGCSCSWPVCTRN
811 chacur 1 GLPVCGETCVGGTCNTPGCTCSWPICTRN
30 kalata B4 GLPVCGETCVGGTCNTPGCTCSWPVCTRD
1 kalata B1 GLPVCGETCVGGTCNTPGCTCSWPVCTRN
513 cO35 GLPVCGETCVGGTCNTPYCFCSWPVCTRD
509 cO33 GLPVCGETCVGGTCNTPYCTCSWPVCTRD
181 cycloviolacin O21 GLPVCGETCVTGSCYTPGCTCSWPVCTRN
605 vitri F GLTPCGESCVWIPCISSVVGCACKSKVCYKD
175 cycloviolacin O15 GLVPCGETCFTGKCYTPGCSCSYPICKKN
153 Hyfl M GNIPCGESCIFFPCFNPGCSCKDNLCYYN
379 Viba 14 GRLCGERCVIERTRAWCRTVGCICSLHTLECVRN
596 Cter N GSAFCGETCVLGTCYTPDCSCTALVCLKN
538 Globa E GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
411 Mra25 GSAILCGESCTLGECYTPGCTCSWPICTKN
533 Globa F GSFPCGESCVFIPCISAIAGCSCKNKVCYKN
574 Oak7 cyclotide GSHCGETCFFFGCYKPGCSCDELRQCYKN
174 cycloviolacin O14 GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
517 cO27 GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
516 cO26 GSIPACGESCFRGKCYTPGCSCSKYPLCAKD
35 vico A GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
41 vico B GSIPCAESCVYIPCITGIAGCSCKNKVCYYN
417 Mra30 GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
754 viphi G GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
753 viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
752 viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
399 Mra29 GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
748 viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN
392 Mra14a GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
939 vitri peptide 2 GSIPCGESCVWIPCISGIAGCSCSNKVCYLN
1016 mech 4 GSIPCGESCVYIPCISSIIGCSCKSKVCYKD
397 Mra17 GSIPCGESCVYIPCISSLLGCSCESKVCYKN
388 Mra4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKN
250 kalata B12 GSLCGDTCFVLGCNDSSCSCNYPICVKD
142 Hyfl B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
143 Hyfl C GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
502 Vpl-1 GSQSCGESCVLIPCISGVIGCSCSSMICYFN
944 vitri peptide 14 GSSCGETCEVFSCFITRCACIDGLCYRN
783 vigno 2 GSSPLCGETCAGGTCNTPGCSCSWPVCVRD
963 vitri peptide 18b GSVFNCGETCVFGTCFTSGCSCVYRVCSKD
245 kalata B9 linear GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
244 kalata B9 GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
817 psypoe 1 GSVICGETCFTTVCNTPGCYCGAYXCTRN
168 kalata B8 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
144 Hyfl D GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
940 vitri peptide 3 GSWPCGESCVYIPCITSIAGCECSKNVCYKN
68 cycloviolin B GTACGESCYVLPCFTVGCTCTSSQCFKN
358 vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
361 vibi J GTFPCGESCVWIPCISKVIGCACKSKVCYKN
943 vitri peptide 9a/53 GTIFDCGETCLLGKCYTPGCSCGSWALCYGQN
393 Mra14b GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
357 vibi F GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
791 vigno 10 GTIPCGESCVWIPCISSVVGCSCKSKVCYKD
55 cycloviolacin O6 GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
28 cycloviolacin O11 GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
788 vigno 7 GTLPCGESCVWIPCISSVVGCSCKNKVCYKN
179 cycloviolacin O19 GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
27 cycloviolacin O8 GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
152 Hyfl L GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
941 vitri peptide 4 GTPCGESCIYVPCISAVFGCWCQSKVCYKD
54 cycloviolacin O5 GTPCGESCVWIPCISSAVGCSCKNKVCYKN
151 Hyfl K GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
59 kalata B5 GTPCGESCVYIPCISGVIGCSCTDKVCYLN
613 hedyotide B1 GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
592 Cter J GTVPCGESCVFIPCITGIAGCSCKNKVCYID
591 Cter I GTVPCGESCVFIPCITGIAGCSCKNKVCYIN
951 vitri peptide 94b GVAVCGETCTLGTCYTPGCSCDWPICKRN
67 cycloviolin A GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
535 Globa B GVIPCGESCVFIPCISAVLGCSCKSKVCYRN
872 chassatide C6 GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
436 Viba 7 GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
556 psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
407 Mra23 GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
871 chassatide C5 GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
45 circulin B GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
805 caripe 1 GVIPCGESCVFIPCISTVIGCSCKDKVCYRN
477 Cter A GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
828 caripe 8 GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
557 psyle F GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
585 Cter C GVPCAESCVWIPCTVTALLGCSCKDKVCYLD
478 Cter B GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
344 kalata B18 GVPCAESCVYIPCISTVLGCSCSNQVCYRN
860 chassatide C16 GVPCAESCVYIPCTITALFGCSCKDKVCYNN
350 cycloviolacin Y4 GVPCGESCVFIPCITGVIGCSCSSNVCYLN
575 Oak8 cyclotide GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
430 Viba 4 GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
405 Mra22 GVPCGESCVWIPCLTSIVGCSCKNNVCTLN
909 Phyb B GVPCGESCVWMYCISAAMGCSCRNKVCYRN
540 Glopa D GVPCGESCVWVPCTVTALMGCSCVREVCRKD
750 viphi C GVPCGESCVYIPCITSVIGCSCSSKVCYIN
601 vitri B GVPICGESCVGGTCNTPGCSCSWPVCTTN
946 vitri peptide 18a GVPICGETCFQGTCNTPGCTCKWPICERN
64 varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN
62 varv peptide C GVPICGETCVGGTCNTPGCSCSWPVCTRN
955 vitri peptide 29 GVPSSDCLETCFGGKCNAHRCTCSQWPLCAKN
65 varv peptide G GVPVCGETCFGGTCNTPGCSCDPWPVCSRN
594 Cter L HEPCGESCVFIPCITTVVGCSCKNKVCYD
593 Cter K HEPCGESCVFIPCITTVVGCSCKNKVCYN
875 chassatide C11 IPCGESCVWIPCISGMFGCSCKDKVCYS
50 circulin E KIPCGESCVWIPCLTSVFNCKCENKVCYHD
49 circulin D KIPCGESCVWIPCVTSIFNCKCENKVCYHD
554 psyle C KLCGETCFKFKCYTPGCSCSYFPCK
808 caripe 4 LICSSTCLRIPCLSPRCTCRHHICYLN
942 vitri peptide 8 PTPCGETCIWISCVTAAIGCYCHESICYR
778 Panitide L3 QAFCGETCLLGKCYTPGCSCHTGICLK
774 Panitide L4 QAFCGETCLLGTCYTPGCRCTAGICLK
780 Panitide L7 QAFCGETCVLGTCYTPGCSCNFGICLK
781 Panitide L8 QDCGETCVLGTCYTPGCSCSAYPLCV
772 Panitide L2 QLPICGETCVLGRCYTPNCRCQYPICVR
771 Panitide L1 QLPICGETCVLGTCYTPGCRCQYPICVR
779 Panitide L5 QLPICGETCVLGTCYTPGCSCAYPICAR
776 Panitide L6 QLPICGETCVLGTCYTPGCSCAYPICVR
886 Phyb L QSISCAETCVWIPCATSLIGCSCVNSICTYTN
140 cycloviolacin H2 SAIACGESCVYIPCFIPGCSCRNRVCYLN
172 violacin A SAISCGETCFKFKCYTPRCSCSYPVCK
32 cyclopsychotride A SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
56 cycloviolacin O7 SIPCGESCVWIPCTITALAGCKCKSKVCYN
86 vhl-1 SISCGESCAMISFCFTEVIGCSCKNKVCYLN
141 Hyfl A SISCGESCVYIPCTVTALVGCTCKDKVCYLN
146 Hyfl F SISCGETCTTFNCWIPNCKCNHHDKVCYWN
885 Phyb K STDCGEPCVYIPCTITALLGCSCLNKVCVRP
884 Phyb J SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
447 Viba 13 TIPCAESCVWIPCTVTALLGCSCKDKVCYN