Protein List

Found 387 entries.


ID Name Sequence
1101 cT38 KIPCGESCVWIPCFTSAFGCYCQSKVCYHS
805 caripe 1 GVIPCGESCVFIPCISTVIGCSCKDKVCYRN
1133 caripe 10 GVIPCGESCVFIPCFSTVIGCSCKNKVCYRN
1134 caripe 11 GVIPCGESCVFIPCISTVIGCSCKKKVCYRN
1135 caripe 12 GVIPCGESCVFIPCFSSVIGCSCKNKVCYRN
1136 caripe 13 GIPCGESCVFIPCFTSVFGCSCKDKVCYRN
806 caripe 2 GIPCGESCVFIRCTITALLGCSCSNNVCYKN
808 caripe 4 LICSSTCLRIPCLSPRCTCRHHICYLN
810 caripe 6 GAICTGTCFRNPCLSRRCTCRHYICYLN
827 caripe 7 GIPCGESCVFIPCTVTALLGCSCKNKVCYRN
828 caripe 8 GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
346 CD-1 GADGFCGESCVYIPCISYLVGCSCDTIEKVCKRN
811 chacur 1 GLPVCGETCVGGTCNTPGCTCSWPICTRN
869 chassatide C1 GDACGETCFTGICFTAGCSCNPWPTCTRN
874 chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN
875 chassatide C11 IPCGESCVWIPCISGMFGCSCKDKVCYS
876 chassatide C12 EYCGESCYLIPCFTPGCYCVSRQCVNKN
862 chassatide C13 GFPCAESCVYIPCTVTALLGCSCRNRVCYRN
864 chassatide C14 GIPCAESCVYIPCTITALFGCSCKDKVCYNN
861 chassatide C15 GIPCAESCVYIPCTITALLGCSCKDKVCYKN
860 chassatide C16 GVPCAESCVYIPCTITALFGCSCKDKVCYNN
863 chassatide C17 IPCGESCVYIPCISAVLGCSCQNKVCYR
859 chassatide C18 GIPCGESCVFIPCISALLGCSCSNKVCYNN
868 chassatide C2 GIPCAESCVWIPCTITALMGCSCKNNVCYNN
870 chassatide C3 GIPCGESCVWIPCISSALGCSCKNKVCYRN
867 chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN
871 chassatide C5 GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
872 chassatide C6 GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
866 chassatide C7 IPCGESCVWIPCITAIAGCSCKNKVCYT
865 chassatide C8 AIPCGESCVWIPCISTVIGCSCSNKVCYR
873 chassatide C9 GIPCGESCVFIPCVTTVIGCSCKDKVCYNN
8 circulin A GIPCGESCVWIPCISAALGCSCKNKVCYRN
45 circulin B GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
48 circulin C GIPCGESCVFIPCITSVAGCSCKSKVCYRN
49 circulin D KIPCGESCVWIPCVTSIFNCKCENKVCYHD
50 circulin E KIPCGESCVWIPCLTSVFNCKCENKVCYHD
51 circulin F AIPCGESCVWIPCISAAIGCSCKNKVCYR
975 cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN
977 cliotide T10 GIPCGESCVYIPCTVTALLGCSCKDKVCYKN
978 cliotide T11 GIPCGESCVFIPCTITALLGCSCKDKVCYKN
766 cliotide T12 GIPCGESCVFIPCITGAIGCSCKSKVCYRD
966 cliotide T13 DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
967 cliotide T14 DTIPCGESCVWIPCISSILGCSCKDKVCYHN
968 cliotide T15 GLPICGETCFKTKCYTKGCSCSYPVCKRN
969 cliotide T16 GSVIGCGETCLRGRCYTPGCTCDHGICKKN
970 cliotide T17 GTVPCGESCVFIPCITGIAGCSCKNKVCYLN
971 cliotide T18 GLPICGETCFTGTCYTPGCTCSYPVCKKN
972 cliotide T19 GSVIKCGESCLLGKCYTPGCTCSRPICKKN
765 cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN
973 cliotide T20 GSAIRCGESCLLGKCYTPGCTCDRPICKKN
974 cliotide T21 DLQCAETCVHSPCIGPCYCKHGLICYRN
979 cliotide T28 GGSIPCGESCVFLPCFLPGCSCKSSVCYLN
980 cliotide T32 GDLFKCGETCFGGTCYTPGCSCDYPICKNN
981 cliotide T33 GFNSCSEACVYLPCFSKGCSCFKRQCYKN
982 cliotide T40 GIPCGESCVFIPCTITALLGCSCKSKVCYKN
983 cliotide T54 GIPCGESCVYIPCTVTALLGCSCKNKVCYRN
984 cliotide T55 GVIPCGESCVFIPCISTLIGCSCKNKVCYRN
976 cliotide T6 SIPCGESCVYIPCITTIVGCSCKNSVCYSN
759 cliotide T8 GIPCGESCVFIPCISSVVGCSCKSKVCYNN
762 cliotide T9 GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
1089 cT22 ARIPCGESCVWIPCTITALVGCACHEKVCYKS
1081 cT23 GFPCGESCVFIPCTVTALLGCSCKDKVCYKN
1091 cT25 GSIRCGERCLLGRCHRPGCTCVRRICRRN
1093 cT26 GFICGESCVYIPCITALLGCSCSNQICSKN
1082 cT27 GVIPCGESCVFIPCITGAIGCSCKSKVCYRN
1096 cT30 GDPLKCGESCFAGKCYTPGCTCSRPICKKN
1098 cT31 GDPLKCGESCFAGKCYTPGCTCDRPICKKN
1103 cT42 DIPCGSTCLHVKCIPPCYCKNKVLCYRN
1083 cT45 CGESCVFLPCFIIPGCSCKDKVCYLN
986 Cter 1 GLPICGETCFGGTCNTPNCVCDPWPICTNN
994 Cter 10 SYIPCGESCVYIPCTVTALLGCSCSNKVCYKN
995 Cter 11 GSIRCGERCLLGRCHRPGCTCIRRICRRN
996 Cter 12 NTAFCGETCVLGTCYTPDCSCKAVVCIKN
997 Cter 13 GSAIRCGERCLLGRCHRPGCTCIRRICRRN
998 Cter 15 GIPCGESCVFIPCTVTALLGCSCKSKVCYKN
999 Cter 18 DLICSSTCLHTPCKASVCYCKNAVCYKN
1000 Cter 19 SIPCGESCVYIPCLTTIVGCSCKSNVCYSN
987 Cter 2 GDPLKCGESCFAGKCYTPGCTCEYPICMNN
1001 Cter 20 GVIPCGESCVYLPCLTTIVGCSCKNNVCYTN
1002 Cter 22 NTAFCGETCVLGTCYTPDCSCTAIVCIKN
1003 Cter 25 GNPIVCGETCFFQKCYTPGCSCDAVICTNN
1004 Cter 28 GVIPCGESCVWIPCISAAIGCSCKKNVCYRN
1005 Cter 29 GALCDERCTYVPCISAARGCSCNIHRVCSMN
988 Cter 3 GAFCGETCVLGTCYTPDCSCKAVVCIKN
1006 Cter 30 GFPICGETCFKTKCYTPGCSCSYPVCKKN
1007 Cter 31 DLQCAETCVHSPCIGPCYCKHGVICYKN
1008 Cter 32 KIPCGESCVWIPCISSILGCSCKDKVCYHN
1009 Cter 33 GDLFKCGETCFGGTCYTPGCSCDYPICKKN
1010 Cter 35 GAFCGETCVLGTCYTPGCSCAPVICLNN
1011 Cter 36 GSPTCGETCFGGTCYTPNCVCDPWPICTKN
1012 Cter 37 GSPTCGETCFGGTCYTPGCVCDPWPICTKN
989 Cter 4 GDPLACGETCFGGTCYTPGCVCDPWPICTKN
990 Cter 5 GEFLKCGESCVQGECYTPGCSCDYPICKNN
991 Cter 7 GDPFKCGESCFAGKCYTPGCTCEYPICMNN
992 Cter 8 GSAFCGETCVLGTCYTPDCSCKAVVCIKN
993 Cter 9 GIPCGESCVYIPCTVTALLGCSCRDKVCYKN
477 Cter A GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
1065 Cter acyc 1 GFCLETCVILPCFSSVAGCYCHGSTCMRG
478 Cter B GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
585 Cter C GVPCAESCVWIPCTVTALLGCSCKDKVCYLD
586 Cter D GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
587 Cter E GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
588 Cter F GIPCGESCVFIPCISSVVGCSCKSKVCYLD
589 Cter G GLPCGESCVFIPCITTVVGCSCKNKVCYNN
590 Cter H GLPCGESCVFIPCITTVVGCSCKNKVCYND
591 Cter I GTVPCGESCVFIPCITGIAGCSCKNKVCYIN
592 Cter J GTVPCGESCVFIPCITGIAGCSCKNKVCYID
593 Cter K HEPCGESCVFIPCITTVVGCSCKNKVCYN
594 Cter L HEPCGESCVFIPCITTVVGCSCKNKVCYD
595 Cter M GLPTCGETCTLGTCYVPDCSCSWPICMKN
596 Cter N GSAFCGETCVLGTCYTPDCSCTALVCLKN
597 Cter O GIPCGESCVFIPCITGIAGCSCKSKVCYRN
598 Cter P GIPCGESCVFIPCITAAIGCSCKSKVCYRN
599 Cter Q GIPCGESCVFIPCISTVIGCSCKNKVCYRN
600 Cter R GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
32 cyclopsychotride A SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
33 cycloviolacin H1 GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
140 cycloviolacin H2 SAIACGESCVYIPCFIPGCSCRNRVCYLN
139 cycloviolacin H3 GLPVCGETCFGGTCNTPGCICDPWPVCTRN
169 cycloviolacin H4 GIPCAESCVWIPCTVTALLGCSCSNNVCYN
2 cycloviolacin O1 GIPCAESCVYIPCTVTALLGCSCSNRVCYN
57 cycloviolacin O10 GIPCGESCVYIPCLTSAVGCSCKSKVCYRN
28 cycloviolacin O11 GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
38 cycloviolacin O12 GLPICGETCVGGTCNTPGCSCSWPVCTRN
170 cycloviolacin O13 GIPCGESCVWIPCISAAIGCSCKSKVCYRN
174 cycloviolacin O14 GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
175 cycloviolacin O15 GLVPCGETCFTGKCYTPGCSCSYPICKKN
176 cycloviolacin O16 GLPCGETCFTGKCYTPGCSCSYPICKKIN
177 cycloviolacin O17 GIPCGESCVWIPCISAAIGCSCKNKVCYRN
178 cycloviolacin O18 GIPCGESCVYIPCTVTALAGCKCKSKVCYN
179 cycloviolacin O19 GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
21 cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN
180 cycloviolacin O20 GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
181 cycloviolacin O21 GLPVCGETCVTGSCYTPGCTCSWPVCTRN
182 cycloviolacin O22 GLPICGETCVGGTCNTPGCTCSWPVCTRN
183 cycloviolacin O23 GLPTCGETCFGGTCNTPGCTCDSSWPICTHN
184 cycloviolacin O24 GLPTCGETCFGGTCNTPGCTCDPWPVCTHN
185 cycloviolacin O25 DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
516 cycloviolacin O26 GSIPACGESCFRGKCYTPGCSCSKYPLCAKD
517 cycloviolacin O27 GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
507 cycloviolacin O28 GLPVCGETCVGGTCNTPGCSCSWPVCFRD
514 cycloviolacin O29 GIPCGESCVWIPCISGAIGCSCKSKVCYKN
53 cycloviolacin O3 GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
515 cycloviolacin O30 GIPCGESCVWIPCISSAIGCSCKNKVCFKN
505 cycloviolacin O31 GLPVCGETCVGGTCNTPGCSCSIPVCTRN
508 cycloviolacin O32 GAPVCGETCFGGTCNTPGCTCDPWPVCTND
509 cycloviolacin O33 GLPVCGETCVGGTCNTPYCTCSWPVCTRD
512 cycloviolacin O34 GLPVCGETCVGGTCNTEYCTCSWPVCTRD
513 cycloviolacin O35 GLPVCGETCVGGTCNTPYCFCSWPVCTRD
546 cycloviolacin O36 GLPTCGETCFGGTCNTPGCTCDPFPVCTHD
52 cycloviolacin O4 GIPCGESCVWIPCISSAIGCSCKNKVCYRN
54 cycloviolacin O5 GTPCGESCVWIPCISSAVGCSCKNKVCYKN
55 cycloviolacin O6 GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
56 cycloviolacin O7 SIPCGESCVWIPCTITALAGCKCKSKVCYN
27 cycloviolacin O8 GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
34 cycloviolacin O9 GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
550 cycloviolacin T1 GIPVCGETCVGGTCNTPGCSCSWPVCTRN
347 cycloviolacin Y1 GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN
348 cycloviolacin Y2 GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTN
349 cycloviolacin Y3 GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTN
350 cycloviolacin Y4 GVPCGESCVFIPCITGVIGCSCSSNVCYLN
351 cycloviolacin Y5 GIPCAESCVWIPCTVTALVGCSCSDKVCYN
67 cycloviolin A GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
68 cycloviolin B GTACGESCYVLPCFTVGCTCTSSQCFKN
69 cycloviolin C GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
70 cycloviolin D GFPCGESCVFIPCISAAIGCSCKNKVCYRN
534 Globa A GIPCGESCVFIPCITAAIGCSCKTKVCYRN
535 Globa B GVIPCGESCVFIPCISAVLGCSCKSKVCYRN
539 Globa C APCGESCVYIPCLLTAPIGCSCSNIVCYRN
536 Globa D GIPCGETCVFMPCISGPMGCSCKHMVCYRN
538 Globa E GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
533 Globa F GSFPCGESCVFIPCISAIAGCSCKNKVCYKN
542 Glopa A GGSIPCIETCVWTGCFLVPGCSCKSDKKCYLN
543 Glopa B GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
544 Glopa C GDIPLCGETCFEGGNCRIPGCTCVWPFCSKN
540 Glopa D GVPCGESCVWVPCTVTALMGCSCVREVCRKD
541 Glopa E GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
113 hcf-1 GIPCGESCHYIPCVTSAIGCSCRNRSCMRN
501 hcf-1 variant GIPCGESCHIPCVTSAIGCSCRNRSCMRN
613 hedyotide B1 GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
746 hedyotide B2 GIQCGESCVWIPCISSAWGCSCKNKICSS
114 htf-1 GIPCGDSCHYIPCVTSTIGCSCTNGSCMRN
141 Hyfl A SISCGESCVYIPCTVTALVGCTCKDKVCYLN
142 Hyfl B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
143 Hyfl C GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
144 Hyfl D GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
145 Hyfl E GEIPCGESCVYLPCFLPNCYCRNHVCYLN
146 Hyfl F SISCGETCTTFNCWIPNCKCNHHDKVCYWN
149 Hyfl I GIPCGESCVFIPCISGVIGCSCKSKVCYRN
150 Hyfl J GIACGESCAYFGCWIPGCSCRNKVCYFN
151 Hyfl K GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
152 Hyfl L GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
153 Hyfl M GNIPCGESCIFFPCFNPGCSCKDNLCYYN
43 Hypa A GIPCAESCVYIPCTITALLGCSCKNKVCYN
1 kalata B1 GLPVCGETCVGGTCNTPGCTCSWPVCTRN
246 kalata B10 GLPTCGETCFGGTCNTPGCSCSSWPICTRD
247 kalata B10 linear GLPTCGETCFGGTCNTPGCSCSSWPICTRD
249 kalata B11 GLPVCGETCFGGTCNTPGCSCTDPICTRD
250 kalata B12 GSLCGDTCFVLGCNDSSCSCNYPICVKD
251 kalata B13 GLPVCGETCFGGTCNTPGCACDPWPVCTRD
252 kalata B14 GLPVCGESCFGGTCNTPGCACDPWPVCTRD
253 kalata B15 GLPVCGESCFGGSCYTPGCSCTWPICTRD
254 kalata B16 GIPCAESCVYIPCTITALLGCKCQDKVCYD
255 kalata B17 GIPCAESCVYIPCTITALLGCKCKDQVCYN
344 kalata B18 GVPCAESCVYIPCISTVLGCSCSNQVCYRN
563 kalata B19 GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
4 kalata B2 GLPVCGETCFGGTCNTPGCSCTWPICTRD
25 kalata B3 GLPTCGETCFGGTCNTPGCTCDPWPICTRD
30 kalata B4 GLPVCGETCVGGTCNTPGCTCSWPVCTRD
59 kalata B5 GTPCGESCVYIPCISGVIGCSCTDKVCYLN
24 kalata B6 GLPTCGETCFGGTCNTPGCSCSSWPICTRN
26 kalata B7 GLPVCGETCTLGTCYTQGCTCSWPICKRN
168 kalata B8 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
244 kalata B9 GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
245 kalata B9 linear GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
37 kalata S GLPVCGETCVGGTCNTPGCSCSWPVCTRN
1013 mech 1 GVIPCGESCVFIPCINKKKCSCKNKVCYRD
1014 mech 2 GLPTCGETCTLGKCNTPKCTCNWPICYKD
1015 mech 3 GLPTCGETCTLGKCNTPKCTCNWPICYKN
1016 mech 4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKD
1017 mech 5 GVIPCGESCVFIPCISSVVGCTCKNKVCYRD
1018 mech 6 GVIPCGESCVFIPCISSVVGCTCKNKVCYRN
1019 mech 7 GIPICGETCTIGTCNTPGCTCSWPVCTRD
1020 mela 1 GKYTCGETCFKGKCYTPGCTCSYPICKKD
1021 mela 2 GKPTCGETCFKGKCYTPGCTCSYPLCKKD
1022 mela 3 GKPICGETCFKGKCYTPGCTCSYPICKKD
1023 mela 4 GKPICGETCFKGKCYTPGCTCSYPICKKN
1024 mela 5 GSAIACGESCFKFKCYTPGCSCSYPICKKD
1025 mela 6 GIPTCGETCFKGKCYTPGCSCSYPICKKD
1026 mela 7 GLPTCGETCFKGKCYTPGCSCSYPICKKN
1130 Mra1 GIPCAESCVYIPCLTSIGCSCKSKVCYRN
390 Mra13 GIPCGESCVYLPCFTTIIGCKCQGKVCYH
392 Mra14a GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
393 Mra14b GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
397 Mra17 GSIPCGESCVYIPCISSLLGCSCESKVCYKN
1131 Mra2 GIPCAESCVYIPCLTSAGCSCKSKVCYRN
405 Mra22 GVPCGESCVWIPCLTSIVGCSCKNNVCTLN
407 Mra23 GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
409 Mra24 GHPTCGETCLLGTCYTPGCTCKRPVCYKN
411 Mra25 GSAILCGESCTLGECYTPGCTCSWPICTKN
413 Mra26 GHPICGETCVGNKCYTPGCTCTWPVCYRN
399 Mra29 GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
1132 Mra3 GSIPCGESCVYIPCITSIVGCSCKSKVCYKN
417 Mra30 GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
400 Mra30 GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
388 Mra4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKN
389 Mra5 GIPCAESCVYIPCLTSAIGCSCKSKVCYRN
576 Oak6 cyclotide 1 GLPVCGETCFGGTCNTPGCACDPWPVCTRN
573 Oak6 cyclotide 2 GLPICGETCFGGTCNTPGCICDPWPVCTRD
574 Oak7 cyclotide GSHCGETCFFFGCYKPGCSCDELRQCYKN
575 Oak8 cyclotide GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
5 palicourein GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
814 paltet 1 GLPICGETCFTGTCNTPGCTCSYPVCTRN
771 Panitide L1 QLPICGETCVLGTCYTPGCRCQYPICVR
772 Panitide L2 QLPICGETCVLGRCYTPNCRCQYPICVR
778 Panitide L3 QAFCGETCLLGKCYTPGCSCHTGICLK
774 Panitide L4 QAFCGETCLLGTCYTPGCRCTAGICLK
779 Panitide L5 QLPICGETCVLGTCYTPGCSCAYPICAR
776 Panitide L6 QLPICGETCVLGTCYTPGCSCAYPICVR
780 Panitide L7 QAFCGETCVLGTCYTPGCSCNFGICLK
781 Panitide L8 QDCGETCVLGTCYTPGCSCSAYPLCV
744 Parigidin-br1 GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
877 Phyb A GIGCGESCVWIPCVSAAIGCSCSNKICYRN
909 Phyb B GVPCGESCVWMYCISAAMGCSCRNKVCYRN
911 Phyb C GIPCGESCVWMYCITATMGCSCRNKVCYKN
878 Phyb D GIPCGESCMWIPCISAAIGCSCTNHVCYKN
879 Phyb E GIPCGESCVWIPCISGVQGCSCSNKICYRN
880 Phyb F GIPCGGSCVWIPCISGVQGCSCSNKICYRN
881 Phyb G GIPCGESCAWIPCISAVQGCSCRNKICYRN
882 Phyb H GLPCGESCIWIECISGAIGCSCRNKVCYRN
883 Phyb I GIPCGESCIWIPCTTTALLGCSCSNKVCYKN
884 Phyb J SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
885 Phyb K STDCGEPCVYIPCTITALLGCSCLNKVCVRP
886 Phyb L QSISCAETCVWIPCATSLIGCSCVNSICTYTN
345 PS-1 GFIPCGETCIWDKTCHAAGCSCSVANICVRN
813 psybra 1 GLPICGETCTLGTCNTPGCTCSWPICTKN
552 psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN
553 psyle B GIPCGETCVAFGCWIPGCSCKDKLCYYD
554 psyle C KLCGETCFKFKCYTPGCSCSYPFCK
555 psyle D GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
556 psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
557 psyle F GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
817 psypoe 1 GSVICGETCFTTVCNTPGCYCGAYXCTRN
985 riden A GLPVCGETCVGGTCNTPGCTCTWPVCTRN
7 tricyclon A GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN
167 tricyclon B GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN
558 vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN
559 vaby B GLPVCGETCAGGTCNTPGCSCTWPICTRN
560 vaby C GLPVCGETCAGGRCNTPGCSCSWPVCTRN
561 vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
562 vaby E GLPVCGETCFGGTCNTPGCSCDPWPVCTRN
61 varv peptide B GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
62 varv peptide C GVPICGETCVGGTCNTPGCSCSWPVCTRN
63 varv peptide D GLPICGETCVGGSCNTPGCSCSWPVCTRN
64 varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN
65 varv peptide G GVPVCGETCFGGTCNTPGCSCDPWPVCSRN
66 varv peptide H GLPVCGETCFGGTCNTPGCSCETWPVCSRN
86 vhl-1 SISCGESCAMISFCFTEVIGCSCKNKVCYLN
138 vhl-2 GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
6 vhr1 GIPCAESCVWIPCTVTALLGCSCSNKVCYN
425 Viba 1 GIPCGEGCVYLPCFTAPLGCSCSSKVCYRN
377 Viba 10 GIPCAESCVYLPCVTIVIGCSCKDKVCYN
443 Viba 11 GIPCGESCVWIPCISGAIGCSCKSKVCYRN
378 Viba 12 GIPCAESCVWIPCTVTALLGCSCKDKVCYN
447 Viba 13 TIPCAESCVWIPCTVTALLGCSCKDKVCYN
379 Viba 14 GRLCGERCVIERTRAWCRTVGCICSLHTLECVRN
386 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN
452 Viba 16 GLPICGETCTLGTCYTVGCTCSWPVCTRN
384 Viba 17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN
375 Viba 2 GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
428 Viba 3 GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
964 viba 30 linear GPPVCGETCVGGTCNTPGCSCSWPVCTRN
965 viba 32 GLPVCGEACVGGTCNTPGCSCSWPVCTRN
430 Viba 4 GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
376 Viba 5 GIPCGESCVWIPCLTATIGCSCKSKVCYRN
433 Viba 6 GIPCGESCVLIPCISSVIGCSCKSKVCYRN
436 Viba 7 GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
439 Viba 8 GAGCIETCYTFPCISEMINCSCKNSRCQKN
440 Viba 9 GIPCGESCVWIPCISSAIGCSCKNKVCYRK
352 vibi A GLPVCGETCFGGTCNTPGCSCSYPICTRN
353 vibi B GLPVCGETCFGGTCNTPGCTCSYPICTRN
354 vibi C GLPVCGETCAFGSCYTPGCSCSWPVCTRN
355 vibi D GLPVCGETCFGGRCNTPGCTCSYPICTRN
356 vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN
357 vibi F GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
358 vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
359 vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
360 vibi I GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
361 vibi J GTFPCGESCVWIPCISKVIGCACKSKVCYKN
362 vibi K GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
35 vico A GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
41 vico B GSIPCAESCVYIPCITGIAGCSCKNKVCYYN
782 vigno 1 GLPLCGETCAGGTCNTPGCSCSWPVCVRN
791 vigno 10 GTIPCGESCVWIPCISSVVGCSCKSKVCYKD
783 vigno 2 GSSPLCGETCAGGTCNTPGCSCSWPVCVRD
784 vigno 3 GLPLCGETCVGGTCNTPGCSCSWPVCTRN
785 vigno 4 GLPLCGETCVGGTCNTPACSCSWPVCTRN
786 vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN
787 vigno 6 GIPCGESCVWIPCISSAIGCSCKGSKVCYRN
788 vigno 7 GTLPCGESCVWIPCISSVVGCSCKNKVCYKN
789 vigno 8 GIPCGESCVWIPCITSAVGCSCKSKVCYRN
790 vigno 9 GIPCGESCVWIPCISSALGCSCKSKVCYRN
172 violacin A SAISCGETCFKFKCYTPRCSCSYPVCK
72 violapeptide 1 GLPVCGETCVGGTCNTPGCSCSRPVCTXN
748 viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN
749 viphi B GLPVCGETCTIGTCYTAGCTCSWPICTRN
750 viphi C GVPCGESCVYIPCITSVIGCSCSSKVCYIN
751 viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN
752 viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
753 viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
754 viphi G GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
755 viphi H GIPCAESCVWIPCTVTAIVGCSCSWGVCYN
36 vitri A GIPCGESCVWIPCITSAIGCSCKSKVCYRN
601 vitri B GYPICGESCVGGTCNTPGCSCSWPVCTTN
602 vitri C GLPICGETCVGGTCNTPGCFCTWPVCTRN
603 vitri D GLPVCGETCFTGSCYTPGCSCNWPVCNRN
604 vitri E GLPVCGETCVGGTCNTPGCSCSWPVCFRN
605 vitri F GTLPCGESCVWIPCISSVVGCACKSKVCYKD
938 vitri peptide 1 GLIPCGESCVWIPCISSVIGCSCKSKVCYKN
944 vitri peptide 14 GSSCGETCEVFSCFITRCACIDGLCYRN
946 vitri peptide 18a GVPICGETCFQGTCNTPGCTCKWPICERN
963 vitri peptide 18b GSVFNCGETCVFGTCFTSGCSCVYRVCSKD
939 vitri peptide 2 GSIPCGESCVWIPCISGIAGCSCSNKVCYLN
947 vitri peptide 20 GDLVPCGESCVYIPCLTTVLGCSCSENVCYRN
948 vitri peptide 21 GGPLDCQETCTLSDRCYTKGCTCNWPICYKN
949 vitri peptide 22a GAPVCGETCFTGLCYSSGCSCIYPVCNRN
952 vitri peptide 23 GLPTCGETCTLGTCYTPGCTCSWPLCTKN
953 vitri peptide 24/28 GEPVCGDSCVFFGCDDEGCTCGPWSLCYRN
961 vitri peptide 24a GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
954 vitri peptide 27a GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
955 vitri peptide 29 GVPSSDCLETCFGGKCNAHRCTCSQWPLCAKN
940 vitri peptide 3 GSWPCGESCVYIPCITSIAGCECSKNVCYKN
956 vitri peptide 30 GFACGETCIFTSCFITGCTCNSSLCFRN
957 vitri peptide 36/37 GGTIFSCGESCFQGTCYTKGCACGDWKLCYGEN
958 vitri peptide 38 GDTCYETCFTGFCFIGGCKCDFPVCVKN
959 vitri peptide 39 GAPICGESCFTGTCYTVQCSCSWPVCTRN
960 vitri peptide 39 linear GAPICGESCFTGTCYTVQCSCSWPVCTRN
941 vitri peptide 4 GTPCGESCIYVPCISAVFGCWCQSKVCYKD
962 vitri peptide 50 GDIPCGESCVYIPCITGVLGCSCSHNVCYYN
942 vitri peptide 8 PTPCGETCIWISCVTAAIGCYCHESICYR
951 vitri peptide 94b GVAVCGETCTLGTCYTPGCSCDWPICKRN
943 vitri peptide 9a/53 GTIFDCGETCLLGKCYTPGCSCGSWALCYGQN
922 vocC GLPVCGETCVGGTCNTPGCSCSWPVCIRN
31 vodo M GAPICGESCFTGKCYTVQCSCSWPVCTRN
40 vodo N GLPVCGETCTLGKCYTAGCSCSWPVCYRN
503 Vpf-1 GIPCGESCVFIPCLTAAIGCSCRSKVCYRN
502 Vpl-1 GSQSCGESCVLIPCISGVIGCSCSSMICYFN